RetrogeneDB ID:
retro_mputfur_655
Organism:
Location:
GL896932.1:9446058-9446479 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.47 %
Coverage:
57.79 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
C14orf166
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 14 open reading frame 166 [Source:HGNC Symbol;Acc:23169]

Genomic region (view in browser)





>retro_mputfur_655
AAGATTCAAGATCAACAAGAAGCAACTGACAGGCTTCTTGGTTTAGCTGTTAGACTTGAA
TATGGAGATAATGCTGAAAAATACAAGTTGGTAACTGATAATACCAAAAAATGCTGACAA
TGCAGCTAAGACTGCAGAGCCATTGACCATTTGAATGTAAATAATCCCAGTTTCAAGGCT
GGTGTAATGGCTTTGGCTAACCTTCTCCAGATTCAGCTGTCATTATAATTACCTGATAAT
GCTTAAGGCAAACCGCGTTTTGATCCAGGAGCACCTGACCCAGGATGAAGGTGCTAAAGC
AAATCAAACAAAGGAAGGCTTGCCTGTTGCTTGAGACAAACATATTCTTAGTTTTGACAT
AGGAGATGCAGTTCTTCATGAAGCTGCCTGAATACTGCAGTTGCTGCATAGAGATGAGCT
A


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNTK-NADNAAKNAEPLI-NLDVNNPDFKAGVMALANLLQIQR-HDDYLVMLKAIRILVQERLTQDA
KIQD.QEA.D.LLGLAVRLEYGDNAEKYK.LV.DNTK.NADNAAK.AEPL...L.VNNP.FKAGVMALANLLQIQ..H..YL.MLKA.R.L.QE.LTQD.
Retrocopy
KIQDQQEATDRLLGLAVRLEYGDNAEKYK-LVTDNTK\NADNAAKTAEPLT/HLNVNNPSFKAGVMALANLLQIQL\HYNYLIMLKANRVLIQEHLTQDE


Parental protein
VAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEEL
.AKANQTKEGLPVA.DKHIL.FD.GDAVL.EAA.IL.LLH..EL
Retrocopy
GAKANQTKEGLPVA*DKHILSFDIGDAVLHEAA*ILQLLHRDEL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide