RetrogeneDB ID:
retro_mputfur_660
Organism:
Location:
GL896932.1:1929058-1929437 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.38 %
Coverage:
62.81 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
PRDX2
Parental gene aliases:
No gene alias available
Parental gene description:
peroxiredoxin 2 [Source:HGNC Symbol;Acc:9353]

Genomic region (view in browser)





>retro_mputfur_660
GGGCTTTCTGACTACTCTCAGTTCACCCACCTGGCTTGGATCAACAAGCCCGATCCTCTT
GAGAAGGAAGGAGGCTTGGACCCCCTGAACATGCCCCTGCCTGCCAATGTAACCAGAAGC
TTGTCCCAAGGTTCTGGTGTGCTGAAGGAAGATGAAGGCATTGCCTCCAGGGGCCTGTTT
ATCATTCATGGTAAGTGTGCACTTCACCAATCGTTGTCAATGATCTGCTTCTGGGTGTTC
CATGGACACAGCTTTGCAGCTGGTCCAAGACTTCTAACCCACAAATGAGCATGGGGAAAT
CTGTTCTACTGGATGCAAGCCAGGCAATGACACAATAAAGCTCACTATGGATGACAGCAA
GGAATACTCCAAACACAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GVSVDSQFTHLAWINTP---RKEGGLGPLNIPLLADVTRNLSEDYGVLKKDEGIAYRGLFIIDGKGVLRQ-ITVNDLPV-GRSVDEVLRLVQAFQYTDEH
G.S..SQFTHLAWIN.P....KEGGL.PLN.PL.A.VTR.LS...GVLK.DEGIA.RGLFII.GK..L.Q.I.VNDL...G.S.D..L.LVQ.F..T.EH
Retrocopy
GLSDYSQFTHLAWINKPDPLEKEGGLDPLNMPLPANVTRSLSQGSGVLKEDEGIASRGLFIIHGKCALHQ/IVVNDLLL/GCSMDTALQLVQDF*PTNEH


Parental protein
GEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
GE.C..G.KPG.DTIK...DDSKEY.SKHN
Retrocopy
GEICSTGCKPGNDTIKLTMDDSKEY-SKHN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide