RetrogeneDB ID:
retro_mputfur_663
Organism:
Location:
GL896932.1:9578019-9578558 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.03 %
Coverage:
67.54 %
Frameshifts:
4
Stop codons:
4


Parental gene:
Parental gene symbol:
CDCA3
Parental gene aliases:
No gene alias available
Parental gene description:
cell division cycle associated 3 [Source:HGNC Symbol;Acc:14624]

Genomic region (view in browser)





>retro_mputfur_663
CTGGCTGGAGTGGTAGACCCCAGTTCACCTAGTGCCAGCGTCCTGCATGCTCCCATCCAG
CCAGAGAGCTCACTAGAGCCAACCCTACAAGCAGGGTAGCAGCTGGAGGGTCCTAATTAG
GCCAAGACCCAGATCCCCGCTCTCCTACCCTTGACATTGCATGGACACCTATGAAGACGA
GCAGCGGAGAGCCCCCAAGCCGACTGGTGAACCGCTGGGTGAAGAATTTGAGACCAAAGC
CCCCCACATGGATCTACCCCCAGAGCCTGCTCTGCCTCTGCAGGCTACTTCACCTTCTAG
GTTGGACTTGCCTCAGGCACCCAGTTTTCCTTTGAGGACCAGATGCCACCTGGGGGCCAG
ACTGAGCTTCCCTCCAAGCAGGTATCCTGCAAGGAGAAAGCAGGACAGCCCTCAGAAACC
CCTTGGCCAGCCAGGGCTTGGATTAGCCCTTAAAAGACCCTGAGACTCCCTGATCATCAC
GTTCTGAGGCTAATAGGTGGACAGTGGATGGCAAGGCACTAGGGAGCTGTCCCCTCACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LARVADPRSPSAGILRTPIQVESSPQPNLPAGEQLEGPDQA-QDSDPRSPTLGIARTPMKTSTGEPSSPLVKQ-LSEVFETEAPRSNLPPEPVLPLEATS
LA.V.DP.SPSA..L..PIQ.ESS..P.L.AG.QLEGP..A.QD.DPRSPTL.IA.TPMKTS.GEP.S.LV...L.E.FET.AP...LPPEP.LPL.ATS
Retrocopy
LAGVVDPSSPSASVLHAPIQPESSLEPTLQAG*QLEGPN*A/QDPDPRSPTLDIAWTPMKTSSGEPPSRLVNR/LGEEFETKAPHMDLPPEPALPLQATS


Parental protein
SSELDLPL-GTQFSLEDQTPPCSQAELPSKQVFSKEEAGQPSETP-MASQGSDKPSRDPETPRSSGSKHNRWKANGKVLGRSPLT
.S.LDLP..GTQFS.EDQ.PP..Q.ELPSKQV..KE.AGQPSETP..ASQG.D.P..DPETP.SS.S..NRW...GK.LG..PLT
Retrocopy
PSRLDLPQ/GTQFSFEDQMPPGGQTELPSKQVSCKEKAGQPSETP/LASQGLD*PLKDPETP*SSRSEANRWTVDGKALGSCPLT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide