RetrogeneDB ID:
retro_mputfur_664
Organism:
Location:
GL896932.1:13142417-13142795 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
97.62 %
Coverage:
94.74 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
PFDN4
Parental gene aliases:
No gene alias available
Parental gene description:
prefoldin subunit 4 [Source:HGNC Symbol;Acc:8868]

Genomic region (view in browser)





>retro_mputfur_664
GCTGCAGAAGATGTCGACGTTACTTTTGAAGATCAACAAAAGATAAACAAATTTGCACGG
AACACGAGTAGAATCACAGAGCTGAAGGAGGAAATAGAAGTTAAAAAGAAACAACTCCAG
AATTTGGAAGATGCTTGTGAGGACATCATGCTTGCAGATGATGATTGCTTAATGATACCT
TATCAAATTGGTGATGTTTTCATTAGCCATTCTCAAGAATAAACACAGGAAATGTTAGAA
GAAGCAAAGAAAAATTTGCAAGAAGAAATCGACGCCTTAGAAGCCAGAGTGGAATCAATT
CAGCGAGTGTTAGCGGATCTGAAAATTCAGTTATATGCAAAATTTGGGAGCAACATAAAC
CTCGAAGCTGATGACAGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACEDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALEARVESI
AAEDV.VTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACEDIMLADDDCLMIPYQIGDVFISHSQE.TQEMLEEAKKNLQEEIDALEARVESI
Retrocopy
AAEDVDVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACEDIMLADDDCLMIPYQIGDVFISHSQE*TQEMLEEAKKNLQEEIDALEARVESI


Parental protein
QRVLADLKVQLYAKFGSNINLEADDS
QRVLADLK.QLYAKFGSNINLEADDS
Retrocopy
QRVLADLKIQLYAKFGSNINLEADDS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide