RetrogeneDB ID:
retro_mputfur_665
Organism:
Location:
GL896932.1:14075260-14075604 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.9 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
PPDPF
Parental gene aliases:
No gene alias available
Parental gene description:
pancreatic progenitor cell differentiation and proliferation factor homolog (zebrafish) [Source:HGNC Symbol;Acc:16142]

Genomic region (view in browser)





>retro_mputfur_665
TTGCCATCCATCCTCTCCAGGGGCTCACTCGTGGCCTCCCACGACTATTACCGAAGCTGT
GGAGGTTCTGCTTCCAGTAACTGGCCCTGTGGAAGCGCAGGGCATCTGGGAGAAGCCACC
TCTCACCACCCCCATCTCCCTAACGCCGACCAGGGTCCCTAGTGGGCAAGCTGCTTTTTC
CAGAAGTCCACTCTCCGGTTTGTGGCTATAGTGTTGGGAGTCCCCCAGATCGCTGACTCT
CCCAGGCCTCCAGCGACTCGATCACCTGTGACTTGGCTCTGGAAGCCACGAGGAAGCAGC
CTAGTGGCCGCCAGCCTGACAAAGCCAATACCGAGCCCCAGTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAIPSSGSLVATHDYYRRRLGSTSSSSSCGSAECAGEAIPHPPGLPKADPGHWWASFFFGKSTVPFMATVLESPERSEPP-QASSGTITSDPAPEAVRK
...I.S.GSLVA.HDYYR...GS.SS...CGSA...GEA..H.P.LP.AD.G..WAS.FF.KST..F.A.VL..P.....P.QASS..IT.D.A.EA.RK
Retrocopy
LPSILSRGSLVASHDYYRSCGGSASSNWPCGSAGHLGEATSHHPHLPNADQGP*WASCFFQKSTLRFVAIVLGVPQIADSP/QASSDSITCDLALEATRK


Parental protein
QPGGR-PGKANVGPPS
QP.GR.P.KAN..P.S
Retrocopy
QPSGRQPDKANTEPQS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide