RetrogeneDB ID:
retro_mputfur_668
Organism:
Location:
GL896933.1:8742090-8742741 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.16 %
Coverage:
52.3 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
ZDHHC6
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger, DHHC-type containing 6 [Source:HGNC Symbol;Acc:19160]

Genomic region (view in browser)





>retro_mputfur_668
CAGGATAGTAAAGCCCGCCAAGCATATAAGGCACTATGATTGCGTCACTGCAGAAGATCT
AACAGGTGTGTGATAAAGATGTACCATTGGTCTCCTTGGATGAACAACTGCTATGGTTCC
CAAAATCATGCTTCCTCCACACTGTTTCTCCTTGAGAACCCCTGGGTTGTATTCATGCTG
CCTTCATCTTTGTTATGACTATGTTTACACAGCTTTATAGTTGGCTCTCCTTTGGGAGAA
ATATGCTGAAGATTGATATGAATGCAGCTTGGAGAGATCCTCTCCAAGGATCCTCTCCAA
TTATTCCCTTCAAGTGAGCAGCATTGGCGGTCACCTTGTTTGCCTAGAGATTAACTTTAG
GAACAACCATTGCTGTTGGGATGTTATTTTGTAACCAGATGAAAACAATTTTCACAAATG
AAACTTCTGTTGAATCCTAGGTTGAAAAAAAAGCTAAAGATCAATTTCAATATTACCAAC
TAGATGAGGTTTTACCTTACGATATGGAAGTAGATGGAAGAACTTTAAATGGGTATTTAC
ATGGTCAGGGTCCCTGAAGGAGATGGGCTAGAGTGGCCAATTACAGAAGGCTGTCACCAA
TAGAACTTAACAGTAGAACAACTGAGACAAAAAACAGATAAAAGAGTCAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGYQNHASFTLFLLL-APLGCIHAAFIFVMTMYTQLYNRLSFGWNTVKIDMSAARRDPL----
Q..K..QAYKA....HCR..NRCV.KM.H..PW.NNC.G.QNHAS.TLFLL...PLGCIHAAFIFVMTM.TQLY..LSFG.N..KIDM.AA.RDPL....
Retrocopy
QDSKARQAYKAL*LRHCRRSNRCVIKMYHWSPWMNNCYGSQNHASSTLFLLE/EPLGCIHAAFIFVMTMFTQLYSWLSFGRNMLKIDMNAAWRDPLQGSS


Parental protein
PIIPFGLAAFAATLFALGLALGTTIAVGMLFFIQMKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDM-GSRWKNFKQVFTWSG-VPEGDGLAWPV
PIIPF..AA.A.TLFA..L.LGTTIAVGMLF..QMK.I..N.TS.ES.....AKD..QYYQLDE..V.PYDM.GSRWKNFK.VFTWSG.VPEGDGL.WP.
Retrocopy
PIIPFK*AALAVTLFA*RLTLGTTIAVGMLFCNQMKTIFTNETSVES*VXXXAKDQFQYYQLDE--VLPYDM/GSRWKNFKWVFTWSG/VPEGDGLEWPI


Parental protein
RKDCHPYSLTIEQLKQKADKRVR
...CH...LT.EQL.QK.DKRVR
Retrocopy
TEGCHQ*NLTVEQLRQKTDKRVR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide