RetrogeneDB ID:
retro_mputfur_671
Organism:
Location:
GL896933.1:5718422-5718776 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
79.34 %
Coverage:
95.2 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS25
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S25 [Source:HGNC Symbol;Acc:10413]

Genomic region (view in browser)





>retro_mputfur_671
AAGGACAAGAAAGATGCCAGAAAGTCAACCAAGAAAGAAAAAGACCCAGTGAACAAAACC
TGGGCTAAGACCAAAAAGAAGTGATCCAAAGGCAAAGTTCAGCGCAAGCTCAATAACCTG
GTCTTGTTTGACAAAGCAAGATATGACAAACTCTATAAGGAAGTTCTCAGCTATAAGCTT
ATAACCTCAGCTGTTGTCTCTGAGAGACTGAAGATCCAAGGTTCCTAGCCAGGGCAGCCC
TCCACGAGTTCCTTAGCAAAAAACTTATGAAACTTGTTTCCAAAGCACAGAGCTCAAGTA
ATTTACACAAGAAATACCAAGGGTGGAGATAACCCAGCTGCTGGTGAAGATGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGS-LARAALQELLSKGLIKLVS-KHR
K.KKDA.KS.KK.KDPVNK...K.KKK..SKGKV..KLNNLVLFDKA.YDKL.KEV..YKLIT.AVVSERLKI.GS.LARAAL.E.LSK.L.KLVS.KHR
Retrocopy
KDKKDARKSTKKEKDPVNKTWAKTKKK*-SKGKVQRKLNNLVLFDKARYDKLYKEVLSYKLITSAVVSERLKIQGS/LARAALHEFLSKKLMKLVS\KHR


Parental protein
AQVIYTRNTKGGDAPAAGEDA
AQVIYTRNTKGGD.PAAGEDA
Retrocopy
AQVIYTRNTKGGDNPAAGEDA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide