RetrogeneDB ID:
retro_mputfur_672
Organism:
Location:
GL896933.1:6165388-6165705 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.39 %
Coverage:
63.16 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
C1orf194
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 1 open reading frame 194 [Source:HGNC Symbol;Acc:32331]

Genomic region (view in browser)





>retro_mputfur_672
ACCTTCATGAGGGAGGAGGTTTATGTTTTTGATCCTGAGATACCAAAGGATGACCTGGAT
TTCTGCTTAGCAGCCTTGTACAATTACCACACAAGGACGTTCGAGAACAAAAGTGAGATA
CACAGCAGACCACCCAGGATACCCATGAAATCATCAAGACCCAATACCCTAAAATGTTTT
TACCCTTTACTCTGCTTCCTTCCATCACTTCCTAGGCTAACATCAGACACTGGATCAACC
CCAAGAAGGAGACTGTCCACAGCATCCAGGGATCCATAGTGTCCCCTCACATCGCGGCCA
CCAATAAAGGCTATTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TSMRRDVYFFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLH-QETTQDTHGIIKTQFPGELLPPPPPPSITSRSNIRYWINPKKESIHSIQGSIVSPH
T.MR..VY.FDPEIPKDDLDF.LAALYN.HT.TF.NKSE...H.Q.TTQDTH.IIKTQ.P...LP....PSITS..NIR.WINPKKE..HSIQGSIVSPH
Retrocopy
TFMREEVYVFDPEIPKDDLDFCLAALYNYHTRTFENKSE--IH/QQTTQDTHEIIKTQYPKMFLPFTLLPSITS*ANIRHWINPKKETVHSIQGSIVSPH


Parental protein
TAATNGGYS
.AATN.GYS
Retrocopy
IAATNKGYS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide