RetrogeneDB ID:
retro_mputfur_673
Organism:
Location:
GL896933.1:7873149-7873981 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.47 %
Coverage:
100.0 %
Frameshifts:
5
Stop codons:
5


Parental gene:
Parental gene symbol:
TRA2B
Parental gene aliases:
No gene alias available
Parental gene description:
transformer 2 beta homolog (Drosophila) [Source:HGNC Symbol;Acc:10781]

Genomic region (view in browser)





>retro_mputfur_673
ATGAGCGACAGCAGCTAGCAGAACTACAGTGAGGGGAATCCTGTTCTGCTTCCAGAGGTG
GAAGTGCTCATGGATCTGGGAAATCTGCAAGGCATACCCCAGCAAGGTCTCGCTCCAAGG
CAGATTCCAGGCATTCCAGATCTGAATCTTGGTTTAGATCCAGACGAAGAAGTTCTCGAA
GGCATTACACAAGATCAAGATCTTGGTCTCGCTCCCATAGACGACAGCAGGTCTTACAAT
TGAGATTATCGAAGACGGCCTAGCCACCGTCACTCTTCCATGTCCACTCGCAGGCATCAT
GTTGGGAATTGGGCAAATCCTGATCCAACTGCTGTCTTGGAGTATTTGGATTGAGCTTGT
ACACTACAGAAAGAGATCTAAGAGAAGTATTCTCTAAATATGGCCCCATTGCTGATGTGT
CCATTGTATAAGACCAGCAGTCTAGACGTTCAAGAGGATTTGCCTTTGTGCATTCTGAAA
ATGTAGATGATGCCAAGGAAGCAAAAGAGCGTGCCAATGGAATGGAACTTGATGGATGTG
GGATCAGAGTTTATTTCTCTATAACAAAAAGACCACATACCCCGACACCAGGGATTTACA
TGGGGAGACCTAGCTATGGCAGTTCACACCGTCAGGATTACTATGACAGGATAGGATCGA
GACTATGATGAGTGAGACTACTACAGCAAATCACACGGAGGAGGAGGAGGAGGATGGACT
GCTGCTCAAGATAGGGATCAGATTTACCGAAAGGTGGTTACCTTCTCCTTACTGTAGTCA
TGGAGGATACAGATCACATTCTAGATCTCAATCATACTCACCTCATCGCTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSDSGEQNYGER-ESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTRSRSRSRSHRRSR-SRSYSRDYRRRHSHSH
MSDS..QNY.E..ES.SASR.GSAHGSGKSARHTPARSRSK.DSR.....SRS.S..RSR.RRSSRRHYTRS..RS.S....R.SRSY..DYRRR.SH.H
Retrocopy
MSDSS*QNYSEG/ESCSASRGGSAHGSGKSARHTPARSRSKADSRH----SRSESWFRSR-RRSSRRHYTRS--RSWSRSHRR\SRSYN*DYRRRPSHRH


Parental protein
SPMSTRRRHVGNRANPDP-NCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITK
S.MSTRR.HVGN.ANPDP.NCCLGVFGLSLYTTERDLREVFSKYGPIADVSIV.DQQSRRSRGFAFV..ENVDDAKEAKERANGMELDG..IRV.FSITK
Retrocopy
SSMSTRRHHVGNWANPDP/NCCLGVFGLSLYTTERDLREVFSKYGPIADVSIV*DQQSRRSRGFAFVHSENVDDAKEAKERANGMELDGCGIRVYFSITK


Parental protein
RPHTPTPGIYMGRPTYGSSRRRDYYD-RGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYR-RRSPSPYYSRGGYRSRSRSRSYSPRRY
RPHTPTPGIYMGRP.YG.S..R..Y...G.DR.YD..DYYS.S....GGGGGGW.AAQDRDQIYR.R..PSPY.S.GGYRS.SRS.SYSP.RY
Retrocopy
RPHTPTPGIYMGRPSYG-SSHRQDYY\TG*DRDYDE*DYYSKSH---GGGGGGWTAAQDRDQIYR\RWLPSPYCSHGGYRSHSRSQSYSPHRY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide