RetrogeneDB ID:
retro_mputfur_677
Organism:
Location:
GL896934.1:670319-670759 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.57 %
Coverage:
84.0 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
TPT1
Parental gene aliases:
No gene alias available
Parental gene description:
tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:12022]

Genomic region (view in browser)





>retro_mputfur_677
GGGTTGTGCCTGAGGGGAAGGGGAAGATGGCCAATAAGACATAGGGTAACATTGATAAGT
AGTTCATTGGTGAAAATGCCTTCACAGAAGGCCCCAAGGACAAAGGGACTCAAAACACAG
TAATCAGTGATGTTGATATTGTCATGAACCATCACCTGCAAGAAATCAGATTCACAAAAG
ACACCCATGAGAAATACATCAAAGATTATATGAAATCAATCAAAGGAAAACTTAAAGAAC
AGAGGTCAGAAAGAGTAAAACCTTTTATGGCAGGGGCTATAGGACAAATCAAGCACATCC
TTGCTAATTTCACCAAGTTCCAGTTCTTTATTTATGAATACATGAATCCAGATAACATGG
TTGTTATCATGAACTACCGGGAGGATGGTGTGACCTCATATATGATTTACTTTAAGGCTG
GTTTAAATGTAAAAATATGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GLCL-EVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKH
GLCL.E..GKM...T.GNID...IG.NA..EGP...GT..TVI..VDIVMNHHLQE..FTK....KYIKDYMKSIKGKL.EQR.ERVKPFM.GA..QIKH
Retrocopy
GLCL/EGKGKMANKT*GNIDK*FIGENAFTEGPKDKGTQNTVISDVDIVMNHHLQEIRFTKDTHEKYIKDYMKSIKGKLKEQRSERVKPFMAGAIGQIKH


Parental protein
ILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
ILANF...QFFI.E.MNPD.MV....YREDGVT.YMI.FK.GL....C
Retrocopy
ILANFTKFQFFIYEYMNPDNMVVIMNYREDGVTSYMIYFKAGLNVKIC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide