RetrogeneDB ID:
retro_mputfur_679
Organism:
Location:
GL896934.1:9401935-9402521 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.87 %
Coverage:
72.86 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
MEMO1
Parental gene aliases:
No gene alias available
Parental gene description:
mediator of cell motility 1 [Source:HGNC Symbol;Acc:14014]

Genomic region (view in browser)





>retro_mputfur_679
CAGACACCTCTATATGTCCTTTATATTGACCAAAAGATTTATGAAGAATTACGGAAGACA
AGAGTGTTTGAACACATGTCTCTGCAGAGAAATAAAGATGAGCACAGTATTGAAATGCTT
TTGCCTTATACAGCTAAAGCCATGGAAAGCCATAAGGATGAGTTTACATTATTCTTGTAC
TGGATGGAGCTCTGACTAAGTCAAAAGAACAGGAATTCAAAAAAACTCTTCAGTAAATAT
CTAGGGGATCCTAGTAATCTCTTTGTGGTTTCTTCTGGTTTTGGCCATTGGGGTCTAAGT
TTCTATTACAGTTACTATGATGAACCCAGGAGAGATTTATAGATCCATTGGACATCTAGA
GAAAATGGATGTGAGTATGACAGAACAACCAGATCCTGTATCTTTTAGCAATTACTTAAA
GAAATACCATAATCCTGTATGTGGAAGACGTCCCATTGTGGTGTTATTAAATGCTATCAC
AGAGCTCCAGAAGAACAGAATCAATATGAGCCTTTCCTTTTTGAATTATGGCCAGTTAGG
CCAGTGTAGGAACTGGCAAGACAGTACAGTGAGTTATTCAGGGGGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFT-IIPVLVGALSESKEQEFGK-LFSKYLADPSNLFVVSSDFCHWG
.TPLY.L.IDQKIY.EL.KT..FE.MSLQ...DEHSIEM.LPYTAKAMESHKDEFT.II.VL.GAL..SKEQEF.K.LFSKYL.DPSNLFVVSS.F.HWG
Retrocopy
QTPLYVLYIDQKIYEELRKTRVFEHMSLQRNKDEHSIEMLLPYTAKAMESHKDEFT/IILVLDGALTKSKEQEFKK\LFSKYLGDPSNLFVVSSGFGHWG


Parental protein
QRFRYSYYDE-SQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAG
..F.Y..Y.....GEIYRSI.HL.KM..S..EQ.DPVSFSNYLKKYHN..CGR.PI.VLLNAITELQKN..NMS.SFLNY.Q..QCRNWQDS.VSY..G
Retrocopy
LSF-YYSYYD\NPGEIYRSIGHLEKMDVSMTEQPDPVSFSNYLKKYHNPVCGRRPIVVLLNAITELQKNRINMSLSFLNYGQLGQCRNWQDSTVSYSGG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide