RetrogeneDB ID:
retro_mputfur_680
Organism:
Location:
GL896934.1:9411729-9412290 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.02 %
Coverage:
78.33 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
ZCCHC17
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger, CCHC domain containing 17 [Source:HGNC Symbol;Acc:30246]

Genomic region (view in browser)





>retro_mputfur_680
ATTAATTCAGGAAGACCCAAGACCGTGAAGGACTTGCCTGCTGTCTACACTGTTTTCCAG
TCAGAGGTTATTATTATGACAGACTATGAAACTTTTATCAAAATCCCAGGCTGTTGGAAG
CAAGGTCTGGTCCTTCGAACTCACATGTCATCCTGTTGCATGAATGAGCCCTCTGAGATA
GCAGAAGTCAGAGAAAAAAATGTCAGGGGGAAGCTTATTGGCTGACAGGTGAAAAATGAT
AGGATAAATGTATACTGCTCCATGAAAGTTGTCAACCAAAGCACTGAGAAAGGCCTTGAC
ACCAACAACGTTATCACTGAGTAAGAAGAGAGGCAGAGGCAGTCCTTCCATGATTACACT
GGGCAGATCACCCTCAAGACTGTCCTGCACACCACCTACAAGCAATGTGGCTGTAAAAAC
TACTTTGCAAAGGATCGTTTTATGCAACCATGAGGAACTAAATATTCTCTGATGCCTGAT
GAGGAAGAGGAGAAGGAAGAGGAAAAATCAGCAGAATCTGAGAAGCCTGACCCGATGAGG
GATTCTAGAAAAAGAAAGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNSGRPETMENLPALYTIFQGELLLITNFGNRLKMAPCFDPGLVHRTHMSSCRVDKPSEIVDVGDK-VWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLD
.NSGRP.T...LPA.YT.FQ.E....T......K...C...GLV.RTHMSSC....PSEI..V..K.V..KLIG...KNDRI.V..SMKVVNQ.T.K.LD
Retrocopy
INSGRPKTVKDLPAVYTVFQSEVIIMTDYETFIKIPGCWKQGLVLRTHMSSCCMNEPSEIAEVREKNVRGKLIG*QVKNDRINVYCSMKVVNQSTEKGLD


Parental protein
PNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSADFEKPDPTRNSSRKRKK
.NNVI.E.EER.R.SF.DYTGQ.ITL..VL.TT.K.CGCK..FAKD.FMQP.GTKYSL.PDEEEEKEE.KSA..EKPDP.R..SRKRKK
Retrocopy
TNNVITE*EERQRQSFHDYTGQ-ITLKTVLHTTYKQCGCKNYFAKDRFMQP*GTKYSLMPDEEEEKEEEKSAESEKPDPMRD-SRKRKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide