RetrogeneDB ID:
retro_mputfur_688
Organism:
Location:
GL896935.1:4846949-4847295 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.07 %
Coverage:
72.78 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL19
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L19 [Source:HGNC Symbol;Acc:10312]

Genomic region (view in browser)





>retro_mputfur_688
CAGCTTTGGAAGAGGCTTACCTCTGGTGTCCTCCATTGTAGCAAAAAGAAGGTCTGGTTG
GATCTCAATGAGACCAACGTAATTACTAGAGTCAACTCCCATCAGCAGATCTGGAAGCTG
ATCAAAGATGGGCTGATCATCGGGGAGCCTGTGACTATCCATTCCTGGAGTCCATGGCAG
AAAAACACTTTGGCCCCACTGGAAAGCAGGCATATGGGCACAGGGGGAGTGAAAGGCTAC
TGCTAGCACTCAGATGACCAGGAAGATTACCTAGATGAGGAGGATGAGAATTATGTGCTG
GCTGCTTAGAAGATACTGTGAACCTAGGAAGACTGACAGCCACATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKG-TANARMPEKVTWMRRMRILR
.L.KRL.S.VL.C.KKKVWLD.NETN.I...NS.QQI.KLIKDGLII..PVT.HS.....KNTLA....RHMG.G..KG.TA...M..K.T.MRRMRI..
Retrocopy
QLWKRLTSGVLHCSKKKVWLDLNETNVITRVNSHQQIWKLIKDGLIIGEPVTIHSWSPWQKNTLAPLESRHMGTGGVKG\TASTQMTRKIT*MRRMRIMC


Parental protein
RLLRRYRESKKIDRHM
.LLRRY.E..K.D.HM
Retrocopy
WLLRRYCEPRKTDSHM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide