RetrogeneDB ID:
retro_mputfur_691
Organism:
Location:
GL896935.1:3365022-3365697 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.79 %
Coverage:
73.87 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
NANOG
Parental gene aliases:
No gene alias available
Parental gene description:
Nanog homeobox [Source:HGNC Symbol;Acc:20857]

Genomic region (view in browser)





>retro_mputfur_691
ATGAGTGTGGGTCCAGCTCAGCTCCAATGCCCACCTGGTCTCAGAGCATCCAATTCTAGG
GATTCTTGTCCAGTGCCTGAGATTTATGGACCTGAAGAACATTATGCATCTTTGCAAATG
TCTTCTGCTGAGACACCCTACATGGAGACCATCTCTCCTCTTTCTTCTTCTATGGATCTG
CTTTTCAGGACAGCCCTGATTCTTCAACCAGTCCCAGAGTAAAACTAAGATCCACTTCTG
TAGAGGAGAGCACAGTGAAGAAGGAAGATACCGACCAGTGAAGAAACAGAAGATCAGAAC
TGCCCTCCCTCAGACCCAGCTACATGTACTCAGTGAGAGATTTCATGGACAGAAATACCT
CAGTCTCCTACAGATGCAAGAACATTCCAACATTCTGAACCTTAACTATAATCAGGTTAA
GACCTGGTTCCAGAACCAGAGAATGAAGTGTAAGAACAGCAACTGGCCAGAGAATAGCAA
CAGTGTGACTCAGAGCAACTCAACAGCTACAGAACATCCAGGCTTCTCTTCCTGTCACCA
GAGATAGCTGATGAACCCTTCTGGAAACCATCCAATATGGAGGATCAGACCTGGTATAAC
CCCAATTGGAGCAACCATTCCTGGAACAGTGAGACCTGGTGTCCCCACACCTGGAATAAC
CAAGCCTGGAACAAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSADPAPPQCRSGPRPPGSRDSSPMPEVCRHEENYAFLQMSSAETPHAETVSPLPSSVDLLV-QDSPDSSTSPKVKLPPTSAEERTGRREDTAQ-GKKQK
MS..PA..QC..G.R...SRDS.P.PE....EE.YA.LQMSSAETP..ET.SPL.SS.DLL..QDSPDSSTSP.VKL..TS.EE.T...EDT.Q..KKQK
Retrocopy
MSVGPAQLQCPPGLRASNSRDSCPVPEIYGPEEHYASLQMSSAETPYMETISPLSSSMDLLF/QDSPDSSTSPRVKLRSTSVEESTVKKEDTDQ/VKKQK


Parental protein
IRTVFSQTQLYVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKCKRWQKNHWPKESKSVTQNSTAATEYPAFYSYHQGHLMNTSANLPIW-
IRT...QTQL.VL..RF..QKYLSL.QMQE.SNILNL.Y.QVKTWFQNQRMKCK......WP..S.SVTQ....ATE.P.F.S.HQ..LMN.S.N.PIW.
Retrocopy
IRTALPQTQLHVLSERFHGQKYLSLLQMQEHSNILNLNYNQVKTWFQNQRMKCK---NSNWPENSNSVTQSNSTATEHPGFSSCHQR*LMNPSGNHPIW/


Parental protein
SSQTWNNPNWSNQTWNSQSWSNHSWNGQSWSN
..QTW.NPNWSN..WNS..W..H.WN.Q.W.N
Retrocopy
EDQTWYNPNWSNHSWNSETWCPHTWNNQAWNN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide