RetrogeneDB ID:
retro_mputfur_692
Organism:
Location:
GL896935.1:10729280-10729719 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.67 %
Coverage:
70.14 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
SNAP23
Parental gene aliases:
No gene alias available
Parental gene description:
synaptosomal-associated protein, 23kDa [Source:HGNC Symbol;Acc:11131]

Genomic region (view in browser)





>retro_mputfur_692
AATAAAGACATGAGAGAGACACAGAAGACTTTAACAGAACCCAATAAGTGCTGTGGCCTT
TGCGTCTGCCCGTGTAATAGGACAAAGAACTTTGAGTCTGGTAAGACCTGCAAGGCAACA
TGGGGAGATGGTGGAGACAGCTCTCCTAGCAATGTTTATCTATGCAGCCAGACCATGTGA
CAAATGGTCAGCTTCAACCAACCACTGGAGCAGCTAGCAGTGGATACATTAAATGTATAA
CCAACGATGCCAGAGAAAATGAGATGGAAGAGAACCAATTCAAGTGGGCAGTATACTAGG
AAACCTAAAAGACTTGGCCCTGGACATGGGCAATGAGATTGAGGCTCAAAATCAACAAAT
AGACTGGCTCACAGAAAAGGCTGACACCAACCAAGACCATACCGATGTCGCCAATGCCTG
AGCAAAGAAACTCATTGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NKDMREAEKTLTELNKCCGLCVCPCNRTKNFESGKAYKATWGDGGDNSPSNV-VSKQPGRVTNGQPQQTTTGAASGGYIKRITNDAREDEMEENL-TQVG
NKDMRE..KTLTE.NKCCGLCVCPCNRTKNFESGK..KATWGDGGD.SPSNV..S.QP..VTNGQ..Q.TTGAAS.GYIK.ITNDARE.EMEEN...QVG
Retrocopy
NKDMRETQKTLTEPNKCCGLCVCPCNRTKNFESGKTCKATWGDGGDSSPSNV/LSMQPDHVTNGQ-LQPTTGAASSGYIKCITNDARENEMEENQ/IQVG


Parental protein
SILGNLKNMALDMGNEIEAQNRQIDRITEKADTNKDRIDVANARAKKLID
SILGNLK..ALDMGNEIEAQN.QID..TEKADTN.D..DVANA.AKKLID
Retrocopy
SILGNLKDLALDMGNEIEAQNQQIDWLTEKADTNQDHTDVANA*AKKLID


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide