RetrogeneDB ID:
retro_mputfur_696
Organism:
Location:
GL896936.1:5952507-5952751 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.51 %
Coverage:
98.78 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
NDUFA4
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687]

Genomic region (view in browser)





>retro_mputfur_696
TTATGCCAGATCCTCAATCAGGCAAAGAAGCATCCAAATTTAGTCTCCCTTTTCATATTT
ATTGAGGTAGCAGATACTGGAGCAGTGCTGTATATCTTGCCCCTGGCATTGTGCAATCCA
GATGTCAGTTGGGATAGGAAGAATAACTCAGAACCCTGTAAAAGACTGGGTCCTCAGTGA
TCAATACAAGTTGTACTCAGTGAATGTAAATTACAGCAAACTGAAGAAAGAAGATCTAGA
CTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LRQIIGQAKKHPSLIPLFVFIGAGGTGAALYVLRLALFNPDVSWDRKNNPEPWNKLGP-NDQYKFYSVNVDYSKLKKEGPDF
L.QI..QAKKHP.L..LF.FI....TGA.LY.L.LAL.NPDVSWDRKNN.EP...LGP..DQYK.YSVNV.YSKLKKE..DF
Retrocopy
LCQILNQAKKHPNLVSLFIFIEVADTGAVLYILPLALCNPDVSWDRKNNSEPCKRLGP\SDQYKLYSVNVNYSKLKKEDLDF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide