RetrogeneDB ID:
retro_mputfur_703
Organism:
Location:
GL896937.1:3903401-3903737 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
61.4 %
Coverage:
74.67 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
UBE2D2
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2D 2 [Source:HGNC Symbol;Acc:12475]

Genomic region (view in browser)





>retro_mputfur_703
ACACTGAAGCGGATTAATACGGAACTTCGTGATTCGGTCCATAACCCTCTAGCATAATAT
TCTGCACGTCTGCTGGGGATGATACCTTTCATTAGCAAGCCACAATCATGGAACTTAATG
ACAACCCTTATCAAGCTGGTGTATTCTTTTTGACAGTTCGTTTTCCTATAGTCTACTCCT
TCAAACCAGCTAAGTTTGCATTTGCAACAAGAATTTATCAACCTGATATTAACAGTAATG
GTAGCTATTGGTCTCAATGTTCTAAGATCACAGTGATGTGCTGCTTTAACTATTTCTAAA
ATTCTTTCATCTCTTTGTTCACTGTTACGTGACCCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TLNQLSHELNDLARDPPAQCSAG-PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGS-ICLDILRSQWSPALTI
TL.....EL.D....P.A..SA....GDD.FH.QATIM..ND.PYQ.GVFFLT..FP..Y.FKP.K.AF.TRIY.P.INSNGS.I.L..LRSQ...ALTI
Retrocopy
TLKRINTELRDSVHNPLA*YSAR/SAGDDTFH*QATIMELNDNPYQAGVFFLTVRFPIVYSFKPAKFAFATRIYQPDINSNGS\IGLNVLRSQ*CAALTI


Parental protein
SKVLLSICSLLCDP
SK.L.S.CSLL.DP
Retrocopy
SKILSSLCSLLRDP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide