RetrogeneDB ID:
retro_mputfur_704
Organism:
Location:
GL896937.1:4730255-4731709 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.19 %
Coverage:
54.95 %
Frameshifts:
9
Stop codons:
9


Parental gene:
Parental gene symbol:
AP2B1
Parental gene aliases:
No gene alias available
Parental gene description:
adaptor-related protein complex 2, beta 1 subunit [Source:HGNC Symbol;Acc:563]

Genomic region (view in browser)





>retro_mputfur_704
CTGGCTAATGCTGTAGGAGCATGCTCTAAAATCAGCGAATCTTGCCCAAACAGCAACCTA
CTTAATCTGAACCAAAGAACATTAATCAGCTGCTGACAGCCCTGAATGAGTGGGCTGGAT
GGGCTCAGATTTTCATCTTGGACCTTCTGTCTCATTACAACCCTAAAGATGAGCGCCAGG
CTCAGAGCACCTGTGAGCCTGTAACTCACTAGCGGTTTCTTGCCAACTGAACCGCGGAGC
TTTCAGCAGTAAGAGTCCTAGTGAAGTTTCTAGAGTTGTTATTCAAGGACTGGGAATACT
GCAATATGCTGCTGAAGGAACTGCCCCTGTGCTTGTCACTGTGCTGCCCAGGGAGCCGGA
GGTATAGTATGTTACCCTGAAGAGTATCAGTGTAATTTTCCAGAAAGGCCCCAAATCTTG
AAGCAGAAAATCGAAGTCTTCTTTGTGAACCACAGTGATCCCATCTATTCTAAACTAGAG
CAGTTGGACATTGTGATTCGTTTGGTGTTCCGAGCCAACACCGCTCAGGTTCTGGCAGAA
TTAGAGGAATACACCACAGAGGTGGATGCTGGCTTTGCTTGTGAAGCTGTGCAGGCCACT
GGCCGGTGAGCCATCAAAGTGAGCTATCTGCAGGGTGCCGTGTGTGCACGCTGTTTGAGC
TCCTCCAGACCAGAGGAAATTATGTGATCCAAGAGGTAACTGTTGTTATCAGGGAGAGCT
TTCACAAATATGCATCAAGTAGGAAAGCACCATGTCACTCGGTCTGAGAACTTAGACTCG
CTGGATGCACCAGACGCTCGAGCAGCTATGATCTGGACTGGGGGAGAACATGCGGAGAGA
ACGGACAGTGCTTCAAGTCACTGGAGAGCTTTCTGGAGGGTTTTCCCGACGAAAGCCCAG
GTGTAGCTCATTCTTCTTACTGCCTTTGTGAAACTGTTTCTCAAGAAACCATGAGAAACA
CAGGAGCTGCCATAGTGAGTCTTGAGTTTGGCAACACAGGATTCTGCTAATTCTGACTTT
CGAGGCTGGGGCTGGATTTATTGGTTCCTTTTCTCAACAGACCCTGTCACAGCCAGAGAA
GCAATCTTGTTTGAGAAGCCACTGGTGTCTGAGGAGGCAGATCTTAGTAAGATCAACTCT
GCTGGAGGGACTAATCTGCCACATGGGTTCTTTGGCCTCCATGTACCATAGCCACCCAAT
ACTTTTATAGAAGGGAGTCATGCAATCCAACACAAACACTCGCCAGTACAACATGGGAGC
ACTGATACAGGTGACAGCCCTTCCCACACCACCACTGCCACCAACCTAAAACAGGCTCAG
GTTAGCCGCTCCCAAGGTGACCTTCTAGGAGACCTTTTAAACCATGACCTTGGCCCCCAG
TCAATGTGCTACTGGCGTCCTCCATTCAGATGGGAGCAGTGGGTCTCTTGGGAGGAGGAC
TAGATGGTCTGGTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VANAVAALSEISESHPNSNLLDLN-PQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSD
.ANAV.A.S.ISES.PNSNLL.LN.P.NIN.LLTALNE...W.QIFILD.LS.YNPKD.R.AQS.CE.VT.....AN....LSAV.VL.KFLELL.KD..
Retrocopy
LANAVGACSKISESCPNSNLLNLN/PKNINQLLTALNEWAGWAQIFILDLLSHYNPKDERQAQSTCEPVTH*RFLAN*TAELSAVRVLVKFLELLFKDWE


Parental protein
YYNMLLKKL-APPLVTLLSGEPEVQYVALRNINLIVQK-RPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKA
Y.NMLLK.L.AP.LVT.L..EPEV.YV.L..I..I.QK.RP.ILKQ.I.VFFV...DPIY.KLE.LDI.IRL...AN.AQVLAEL.EY.TEVD..F...A
Retrocopy
YCNMLLKEL/APVLVTVLPREPEV*YVTLKSISVIFQK/RPQILKQKIEVFFVNHSDPIYSKLEQLDIVIRLVFRANTAQVLAELEEYTTEVDAGFACEA


Parental protein
VRAIGRCAIKV-EQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPN-KYESIIA-TLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFL
V.A.GR.AIKV.E.SA...V.TL..L.QT..NYV.QE..VVIR..F.KY...K.ES....T..ENLDSLD.PDARAAMIW..GE.AER.D.A......F.
Retrocopy
VQATGR*AIKV/ELSAGCRVCTLFELLQTRGNYVIQEVTVVIRESFHKYAS/K*ESTMS/TRSENLDSLDAPDARAAMIWTGGEHAERTDSASSHWRAFW


Parental protein
EGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETD-LIEPTLLDELICHIGS
..F.....QV.L.LLTA.VKLFLKKP.ETQEL...VLSLATQDS.N.D.R..G.IYW.L.STDPVTA.E..L.EKPL.SEE.D.L...TLL..LICH.GS
Retrocopy
RVFPTKA-QV*LILLTAFVKLFLKKP*ETQELP**VLSLATQDSANSDFRGWGWIYWFLFSTDPVTAREAILFEKPLVSEEAD\LVRSTLLEGLICHMGS


Parental protein
LASVYHK-PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLG-PPVNVPQVSSMQMGAVDLLGGGLDSLL
LAS.YH..PPN.F.EGSH.I..KH.P..HGSTD.GDSP..TTTATNL.Q.QV..SQGDLLGDLLN.DLG.PPVNV...SS.QMGAV.LLGGGLD.L.
Retrocopy
LASMYHS/PPNTFIEGSHAIQHKHSPVQHGSTDTGDSPSHTTTATNLKQAQVSRSQGDLLGDLLNHDLG/PPVNVLLASSIQMGAVGLLGGGLDGLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide