RetrogeneDB ID:
retro_mputfur_705
Organism:
Location:
GL896937.1:10382169-10383448 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.51 %
Coverage:
54.78 %
Frameshifts:
4
Stop codons:
5


Parental gene:
Parental gene symbol:
HADHA
Parental gene aliases:
No gene alias available
Parental gene description:
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit [Source:HGNC Symbol;Acc:4801]

Genomic region (view in browser)





>retro_mputfur_705
GGTCAGGTTCTGTGCAAGAAGAATCAACATGGAGCACCATAGAAGGAGGTTAAGTATCAA
GCCATTCTTGGTGCAGGGCTGATCGGTGCCTGCATCGCCCAAATCCCCAAGGATTGGTGC
CTAAAGAATGTATATAATGATGCTTCACTAGGTGGGCTGCGCTGAGGACAGCAACAAGTA
TTCAGAGAACTGAAAGATAATGTGAAGAAGAAAACCCTATCATCATCTCAAGGGGACTCC
ATTCAGCAACTGACCAGGCAGCTCAATTCCTAGACCTTTGAAAAGGCCAGTTGAAGGCCA
AAGGTGATCAGAGCTAGTTCTGAGGACCTTAGTCTTAAGCACAGATGCTAAAAGAAGTAG
AAAGGATGATTCCAGATCACTGTGTTTTTGCCAGTAATACATCAGCTCTCCCAATCAATG
AAGTTGCCACTGTCAGACAAAGACCTGAGCAGGTGATTGGCAGACATTACTTCTCTCCTG
TGGAAAAGATGCAGCTGCTGGAGATGATCACCCCCCAAACCCCCCAAAACATCTAAGGAC
ACAATGTTTCTGCTGTAGCACTCCTTCTCAAGCAGGGCAAGGTCACCATTGTGATTAAGG
ATGGGCCTGTCTTCTGGACCAACAAGTGTCTCATACCCATGATGTCTGCAGTCATCAGTA
TTCTCCACAAAGGAGATGACCCTAAGAAGCTGGATTCCCTTACCAGGAGCTTTGGCTTTC
CTGTGGAAGCTGCCACACTGGTGGGATGAAGTTGGCATGGATGTAGCAAACTTCATAGAA
GAGGTAGGCAAAGCTTTTAGGGAGAGGGTTGAAGGTAGAAGCCTAGAGCTTCTGAAGCAG
ATGGTATCCCAGGGCTTCGGAGGTCATATGTCTGGAAGGGCTTTCACATCTACCAGGAAA
GTGTGAAAAATCAGAGTTTGAATTCTGAGATGCATAGTAGTTTGGTAAGCCAGAATCTAT
CTCCTATCTCTGATGGTTCTTCTGACAATGACATCGGGTACTGCCTGGTGACCAGACTCA
TGAATGAGGCCATCAAAGCCTACCAGAAGAGATGTTGGCCACACCAGCAGAGGGATATGT
GAGTACAGTCGTTGGACCAGGATGTCCCCTAGCCAGGCCCCTCCTTGGAGGGTCCTGCTT
CCACCCTGTGTTTCTGTGGGGAGCTCCGGAGAATGTGGACCAGCTCAGGAAGAACAAGGC
TGCCTACAGAAAGAAGCTTACCCCAAACCAGCTGCTAACTGGTCTAATAAATGCTACCAG
CCCTAATAAAAAGTTTTAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GQVLCKKNKFGTPQKEAKHLAILGAGLMGAGIAQVSVDKGLRTILKDATLAGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKAD--
GQVLCKKN..G.P.KE.K..AILGAGL.GA.IAQ...D..L.....DA.L.GL..GQQQVF..L.D.VKKK.L.S...DSI...LT.QL....FEKA...
Retrocopy
GQVLCKKNQHGAP*KEVKYQAILGAGLIGACIAQIPKDWCLKNVYNDASLGGLR*GQQQVFRELKDNVKKKTLSSSQGDSI-QQLTRQLNS*TFEKAS*R


Parental protein
-MVIEAVFEDLSLKHR-VLKEVEAVIPDHCVFASNTSALPINEIAAVSKRPEKVIGMHYFSPVDKMQLLEIIT--TDKTSKDTTASAVAVGLKQGKVIIV
..VI.A..EDLSLKHR..LKEVE..IPDHCVFASNTSALPINE.A.V..RPE.VIG.HYFSPV.KMQLLE.IT..T.........SAVA..LKQGKV.IV
Retrocopy
PKVIRASSEDLSLKHR/MLKEVERMIPDHCVFASNTSALPINEVATVRQRPEQVIGRHYFSPVEKMQLLEMITPQTPQNI*GHNVSAVALLLKQGKVTIV


Parental protein
VKDGPGFYTTRCLAPMMSEVLRILQEGVEPKKLDSLTTSFGFPVGAATLV-DEVGVDVAKHVSEDLGKAFGERFGGGSVELLKQMVSRGFLGRKSG-KGF
.KDGP.F.T..CL.PMMS.V..IL..G..PKKLDSLT.SFGFPV.AATLV.DEVG.DVA....E..GKAF.ER..G.S.ELLKQMVS.GF.G..SG.KGF
Retrocopy
IKDGPVFWTNKCLIPMMSAVISILHKGDDPKKLDSLTRSFGFPVEAATLV\DEVGMDVANFI-EEVGKAFRERVEGRSLELLKQMVSQGFGGHMSG/KGF


Parental protein
YIYQEGVKNKNVNSDMDGILASLKVPPKSEVSSDEDIQYRLVTRFVNEAVMCLQ-EGILATPTEGDIGAVFGLGFP---PCLGGP-FRFVDLYGAQKVVD
.IYQE.VKN...NS.M...L.S....P.S..SSD.DI.Y.LVTR..NEA....Q.E..LATP.EG....V.G.G.P...P.LGG..F..V.L.GA...VD
Retrocopy
HIYQESVKNQSLNSEMHSSLVSQNLSPISDGSSDNDIGYCLVTRLMNEAIKAYQ/EEMLATPAEGYVSTVVGPGCPLARPLLGGSCFHPVFLWGAPENVD


Parental protein
RLRRYEAAYGKQFTPCQLL--IDHANSPNKKFY
.LR...AAY.K..TP.QLL.....A.SPNKKFY
Retrocopy
QLRKNKAAYRKKLTPNQLLTGLINATSPNKKFY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide