RetrogeneDB ID:
retro_mputfur_715
Organism:
Location:
GL896940.1:1734313-1734861 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
81.52 %
Coverage:
66.06 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
UQCC
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquinol-cytochrome c reductase complex chaperone [Source:HGNC Symbol;Acc:15891]

Genomic region (view in browser)





>retro_mputfur_715
ATGGTATTGCTGGTGCGAGTCCTTAGGAACCAGATTACTATTTCCCAGTGGGTTGCAGTT
TGCAGCTGATTGGAACCTGTATCTTCTACACAGGGATAGTAGGGCAGGTCTCTGTCTGGT
ACTTTCCAGTGTCCTCGGAAGAGCCAGTCCCTAGAATGTGGTGGGTCAGAACTGATGCCT
GGGATAGATGTTTAGTGGAGTAGGAAGTATCACACCACAAATAAGCTTTCTACTACCAAA
TATTCACCACAGCCTATGGAGGAGAAGGTTGGTGCCTTCATGAAGATAACAGAAGCCATG
GGATTTATAGGACCTTTGAAATACAGTAAATGGAAGATTAAGGTTGTAGCCCTGCGCATG
TATACTAGCTGTGTGGAGAAAACTGACTTTGAGGAATTCTTTCTAAGGTGTCAGATGCCT
GATACATTCAATTCATGGTTTCTTATGACTCTGCTTCACATCTGGGTGTGTCTAGTCCAA
ATGAAGCAGGAAGGGCAGAGTGGGAAATACTTGTGTGGGATCATAGTTCATTTATGTGGG
ACGATGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MALLVRVLKNRINISPWVPVCSRLVPMSSTQGQWGRALSGTFQWPQMSQSLECGGSEQIPGIDVQWSRKYHTTNKLSTTKDSPQPVEEKVGAFTKIIEAM
M.LLVRVL.N.I.IS.WV.VCS.L.P.SSTQG..GR.LSGTFQ.P..SQSLECGGSE..PGIDV.WSRKYHTTNKLSTTK.SPQP.EEKVGAF.KI.EAM
Retrocopy
MVLLVRVLRNQITISQWVAVCS*LEPVSSTQG**GRSLSGTFQCPRKSQSLECGGSELMPGIDV*WSRKYHTTNKLSTTKYSPQPMEEKVGAFMKITEAM


Parental protein
GFTGPLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMPDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVH-FMWEDV
GF.GPLKYSKWKIK..ALRMYTSCVEKTDFEEFFLRCQMPDTFNSWFL.TLLH.W.CLV.MKQEG.SGKY.C.IIVH.FMW.DV
Retrocopy
GFIGPLKYSKWKIKVVALRMYTSCVEKTDFEEFFLRCQMPDTFNSWFLMTLLHIWVCLVQMKQEGQSGKYLCGIIVH/FMWDDV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide