RetrogeneDB ID:
retro_mputfur_718
Organism:
Location:
GL896940.1:5285010-5286284 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.29 %
Coverage:
69.95 %
Frameshifts:
4
Stop codons:
3


Parental gene:
Parental gene symbol:
TOX4
Parental gene aliases:
No gene alias available
Parental gene description:
TOX high mobility group box family member 4 [Source:HGNC Symbol;Acc:20161]

Genomic region (view in browser)





>retro_mputfur_718
GGAAATGACAATTACCTGATGATCACAGGGTCCTCACACCCCTTCCTCTCAGGTGCCAGG
ACATTCCATACACCAAGCTTGGGAGATGAGGTATTTGAAACCCCACCTATCTCCTTGGAT
TCTGTTCCCTCACTGACTATCTCAGATGTGTTTGGTCACTTTGAAGACCTGGAAAACCCC
TCCCCCTCTCAGGATGGCAGCTTCTCAGCCCAGTATGGGGTCTAGACATTGGATATGCCT
GTAGCCGTGACCCATGGCTTGATGGAGCAAGGTTGGAGGCTCCTGACTGGGGGCTTGACC
ATGGACTTGGACCACTCTTTAGGAGCTCAGTAGAAGTGCAGCCCACCTGTTACAATAGAT
GTATCAATGACAGACGCGCCTCTGGTGCGATGGGGCATAGCCAGTTGACCACCATTTATC
AGTTGAACCAAGTTCTCAACTCAGTTTGAGCTTAGGTGGCATTCTGCCACCTGCCAAGTC
ACCCACAAATCGTCTTTCAGCCACCACTTCACCTACTAGTTCACTTTACGAGGTTGGTGT
TGAGGATTTCCAGAGGCAACCAGCCAGAAGACAGTTGTGAAATCAGGAAAAAAGCAGAAG
GCCCCAAAGATGAGAAAAAAGAAAGATCCTAATGAGCCTCAGAAGCCAGATTCAGCATCT
GCTTTAGTCTTCCATGATACACAGGCTGCCATCAAGGGACAGAATCCCAGTGCCACTTTT
GGGGAGGTTTCAAAAATTGTGGCCGCCATGTGGGATAGTCTTAGTGAGGAGCAAAATCAG
GTGTGTAAGAGAAAAACCAAAGCTGCCAAGAAAGAGCATCTGAAGGTTCTGACTGCACAT
AAAGACACTCAAGAGTGTCAGGCCACTGTGGGAACAGGAGAATTGGACCCATTGCTGCTG
TCACAGACTCCTCCACCTCTTGTGGCTACTGTTGACCCAACGTCTCTAGCACCAGCCTCA
ACAGAGCCCCTTGCCCTGTCCCCTCCCATTGTTAACTCCACTCTTTCCTCCTATGTGGCA
AACCAAGCATCTTCTGGGGCTGGGGCTTAGCTCCATGTCACCATGTTGGTTATTACCAAA
CAGCTGTTGCCCTCTTCTATGACTATATCTCAAGGAGGGATGGTTTCCATTATCCCAACC
ACAGTGGTGACCTCCCAGGGGATCCATCCAGGCCAAACCAGTGCAGCCACTCTCCAGCCC
AGTCAACAAGGCCAAATTATCACTTGCTCAGTATTGCAGCAGCAGCAGCAGCTTCCACAC
TGACAACACCCCCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLT
GNDNYL.ITG.SHPFLSGA.TFHTPSLGDE.FE.PPISLDS.PSL..SDV.GHF.DL..PS.SQDGSFSAQYGV.TLDMPV..THGLMEQG..LL.GGLT
Retrocopy
GNDNYLMITGSSHPFLSGARTFHTPSLGDEVFETPPISLDSVPSLTISDVFGHFEDLENPSPSQDGSFSAQYGV*TLDMPVAVTHGLMEQGWRLLTGGLT


Parental protein
MDLDHSIGTQYSANPPVTIDVPMTD-MTSGLMGHSQLTTIDQ-SELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPS-QKTVV
MDLDHS.G.Q....PPVTIDV.MTD...SG.MGHSQLTTI.Q..E.SSQL.LSLGG..ILPPA.SP..RLS.T.SPTSSL.E.GVEDF.RQ.P..QKT.V
Retrocopy
MDLDHSLGAQ*KCSPPVTIDVSMTD/RASGAMGHSQLTTIYQ/VEPSSQLSLSLGG--ILPPAKSPTNRLSATTSPTSSLYEVGVEDFQRQ-PA/QKT-V


Parental protein
VEAGKKQKAPKKRKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYKDNQECQATVET
V..GKKQKAPK.RKKKDPNEPQKP.SA.AL.F.DTQAAIKGQNP.ATFGEVSKIVA.MWDSL.EEQ.QV.KRKT.AAKKE.LK.L.A.KD.QECQATV.T
Retrocopy
VKSGKKQKAPKMRKKKDPNEPQKPDSASALVFHDTQAAIKGQNPSATFGEVSKIVAAMWDSLSEEQNQVCKRKTKAAKKEHLKVLTAHKDTQECQATVGT


Parental protein
VELDPVPPSQTPSPPPMATVDPASPAPASTEPPALSPSIVVNSTLSSYVANQASSGAGGQPNITKLIITKQMLPSSITMSQGGMVTVIPATVVTSRGIQL
.ELDP...SQTP.PP..ATVDP.S.APASTEP.ALSP.I.VNSTLSSYVANQASSGAG.....T.L.ITKQ.LPSS.T.SQGGMV..IP.TVVTS.GI..
Retrocopy
GELDPLLLSQTP-PPLVATVDPTSLAPASTEPLALSPPI-VNSTLSSYVANQASSGAGA*LHVTMLVITKQLLPSSMTISQGGMVSIIPTTVVTSQGIHP


Parental protein
GQTSTATIQPSQQAQIVTRSVLQ-AAAAAAASMQLPP
GQTS.AT.QPSQQ.QI.T.SVLQ.AA.AAA.....PP
Retrocopy
GQTSAATLQPSQQGQIITCSVLQ/AA-AAASTLTTPP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide