RetrogeneDB ID:
retro_mputfur_719
Organism:
Location:
GL896940.1:7270822-7271089 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
64.84 %
Coverage:
57.59 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
DYDC1
Parental gene aliases:
No gene alias available
Parental gene description:
DPY30 domain containing 1 [Source:HGNC Symbol;Acc:23460]

Genomic region (view in browser)





>retro_mputfur_719
CTGAATCCAATAGAGTGGGTAGTATTGTGGATTTACAAGTATAAGGAGATGTGGCTGGAG
TAACTGAGACAAAAGGAAATGGCCAACGTGGAGCATGAATAAAAACCAGCTCTGATGGGG
CAAGAAATGATGGAGAGACTCAAGTCAGAGGAGCTCCTGTTTCAGCAGCAACAGCTAATA
TTCTAGCTGGAGTTGGAAATGCAAGAAAAAGACAGGAGATTAGGAGAACTGCAGAGAGCT
CAAGAACAACTAGAGAAGGAGATGAGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VDPIEYLGLWIYKYKENMTMEQLRRKEMADLEHERELAVIEREMMERLKAEELLFQQQQLAFQLELEMQEKERQRIEELRRTQEELEKDVT
..PIE...LWIYKYKE.M..E.LR.KEMA..EHE...A....EMMERLK.EELLFQQQQL.F.LELEMQEK.R.R..EL.R.QE.LEK...
Retrocopy
LNPIEWVVLWIYKYKE-MWLE*LRQKEMANVEHE*KPALMGQEMMERLKSEELLFQQQQLIF*LELEMQEKDR-RLGELQRAQEQLEKEMS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide