RetrogeneDB ID:
retro_mputfur_720
Organism:
Location:
GL896941.1:1072571-1073132 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
85.03 %
Coverage:
94.92 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
TMEM126A
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 126A [Source:HGNC Symbol;Acc:25382]

Genomic region (view in browser)





>retro_mputfur_720
AAGGAGGACTTAATCTTCAATATCATAACTAGAAAAATTAACCAACTCCCAGAAGCAGAA
AGGAATCTGCTCGAACATTGATCAACATATGTTGGACTTAACGTTGGTCTCTGTGGTCTA
ATAGCAAATAGTCTTTTTTGACGCATCTTAAATGTGACAAAGGCTTGTATAGCTGCTGGC
TTACCAATGGCAATGATCCCATTTTTGATTGCGGACTTATTTTACGAAGATTTTGTAAGT
TTACCTTTGTATACAGGTGATTTGAACTGTGAAACCTGTACCATAACACAGGGTGGACTA
GTTGGTCTTGTTTTGGGTGGTCTGTACACTGTTATCTTGGCTATACCTGTGAACTGTGGC
CTAGCAGCCAGGTATGAGTCAGCCCCGCTACCAGGGAAAGGAAACTTCTTAACTTACTGG
ACTAGAATTTCTAAGCCTGTCTTTAGAAAGATGTTATTTCCCGTTTTGCTCTAGACTATG
TTTGCAGCATACCTTGGATCTAGACAATATAAACTAATTATAAAGGCCCTTCAGTTACCT
GAACCTGGCCTAGAAATTCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KENLIFNIITRKINQLPEAERNLLEHGSAYVGLNAGLCGLIANSLFRRVLNVTQARIAAGLPMSVIPFLTADLSYRGFVSLPLITGDLNCETCTITRGGL
KE.LIFNIITRKINQLPEAERNLLEH.S.YVGLN.GLCGLIANSLF.R.LNVT.A.IAAGLPM..IPFL.ADL.Y..FVSLPL.TGDLNCETCTIT.GGL
Retrocopy
KEDLIFNIITRKINQLPEAERNLLEH*STYVGLNVGLCGLIANSLF*RILNVTKACIAAGLPMAMIPFLIADLFYEDFVSLPLYTGDLNCETCTITQGGL


Parental protein
VGLVLGGLYPIILAIPVNGGLAARYESAPLPEKGNILTYWTRVSKPIFRKMLFPILLQTMFAGYLGSKQYKLFIKALQLPEPGLEIQ
VGLVLGGLY..ILAIPVN.GLAARYESAPLP.KGN.LTYWTR.SKP.FRKMLFP.LL.TMFA.YLGS.QYKL.IKALQLPEPGLEIQ
Retrocopy
VGLVLGGLYTVILAIPVNCGLAARYESAPLPGKGNFLTYWTRISKPVFRKMLFPVLL*TMFAAYLGSRQYKLIIKALQLPEPGLEIQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide