RetrogeneDB ID:
retro_mputfur_726
Organism:
Location:
GL896941.1:4032242-4032498 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.28 %
Coverage:
98.84 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
C2orf76
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 2 open reading frame 76 [Source:HGNC Symbol;Acc:27017]

Genomic region (view in browser)





>retro_mputfur_726
CTAAAGCAAGATGAGCCCTTAAGGACAAGCCTCTCATCGCCATTCAGAAATTACAAATAC
GATAGACAAAAGATTTTTCGCTGAGCTTATAAACCAAAGAAAAGCGAACTTGTGTTGAGT
TTGGGAGATGATGACAGATTCTGTCTTAAAAGAAGACAGGACTCTGAAAGCAGCTAGAAT
CGCCAATGGAACTGAAATTGCATTCTTTTGTGAAGAAGATTATAAGAACTACTAAACTAA
TCCCATTTAATCCTGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VNMDIPLRTSLPPPFRNYKYDKLKIVHQAHKAKTNELVLSLEDDDTL-MLEEDCTLRAAGIAHETEIAFFCEEDYKNYKANPISSW
...D.PLRTSL..PFRNYKYD..KI...A.K.K..ELVLSL.DDD....L.ED.TL.AA.IA..TEIAFFCEEDYKNY..NPI.SW
Retrocopy
LKQDEPLRTSLSSPFRNYKYDRQKIFR*AYKPKKSELVLSLGDDDRF\VLKEDRTLKAARIANGTEIAFFCEEDYKNY*TNPI*SW


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide