RetrogeneDB ID:
retro_mputfur_727
Organism:
Location:
GL896941.1:7289348-7289799 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.79 %
Coverage:
57.47 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
DNAJC9
Parental gene aliases:
No gene alias available
Parental gene description:
DnaJ (Hsp40) homolog, subfamily C, member 9 [Source:HGNC Symbol;Acc:19123]

Genomic region (view in browser)





>retro_mputfur_727
GAAGACATTCAAGAATTTGGAAAGATATACAAAGGTTCTGAGGAAGAGCTGGCAATATTA
AACAAAACTACGTAAAACTTTAAGAGTGACCTAGATCAGCTCACACAGTCTATGCTATAT
GTGGAGTATGCTGAAGAACCCAGAATATGAAACCTCCTTCAGCAAACCAATCACACCAGG
GAGGTGCTATCCTATAATGCTTTCGTCAAAGAATCAAACTGAAAGATGAATGCTAGGAAA
GGATGGCTCAGGAAGAGGCTAAAGATCCAGATATAACCTGGAAGGCACTGGGGGGCATGA
TGAAGAAAGAGGTGGATAAGCTAAAACCACTGTTCAAAGCAGGCAAAAGGATGGGCAACA
GGAAATGGACAATGTTCTGGCTCAGATAAAATCAAAGTACTACAAACCTTCCAAAGGAGG
AGAGGAAAGAGCTCTCAAAAAAGAAAGTAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTDEPRIRNIIQQAIDAGEIPSYNAFVKESKQKMNARK-RRAQEEAKEAEISRKELG-
EDIQ.F.K.YKGSEEELA........FK.D.DQ...S.L.V.Y..EPRI.N..QQ.....E..SYNAFVKES..KMNARK.R.AQEEAK...I..K.LG.
Retrocopy
EDIQEFGKIYKGSEEELAILNKTT*NFKSDLDQLTQSMLYVEYAEEPRI*NLLQQTNHTREVLSYNAFVKESN*KMNARK/RMAQEEAKDPDITWKALGG


Parental protein
-LDEGVDNLKSI-IQSRQKDRQKEMDNFLAQMEAKYCKPSKRGGKKTPLKKEKK
.....VD.LK....QSRQKD.Q.EMDN.LAQ...KY.KPSK.GG....LKKE.K
Retrocopy
MMKKEVDKLKPL/VQSRQKDGQQEMDNVLAQIKSKYYKPSK-GGEERALKKESK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide