RetrogeneDB ID:
retro_mputfur_734
Organism:
Location:
GL896942.1:11342027-11342628 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
86.7 %
Coverage:
100.0 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
Apool
Parental gene aliases:
No gene alias available
Parental gene description:
apolipoprotein O-like [Source:MGI Symbol;Acc:MGI:1915367]

Genomic region (view in browser)





>retro_mputfur_734
CTTCCCATATATACTGCACCACCTCTGCAGTCTAAATATGTTGAAGAGTAGCCTGGTCAT
TTAGAAATGGGCTTTGCATCCATCCTCAGTACAACTGGTCATTAAATTGGCTGGTGCAAG
GGTGTTTATGTGTTTGTGAACAATGGGATAATGGATACAGTACAATTTGGAAAAGATGCA
TATGTCTACTGAAGAATCCACCTCAAGATTTTCTTCCAAAACTTGGAGTGATTACAGTTT
CAGGATTGGCAGGCTTGGTTTCAGCAAGAAAAGGTTCTAGGTTTAAAAAAAATTGCATAT
CCACTGGGACTGGCCACCTTCGGAGCAACTGTTTGCTACCCAGTTCAGTCAGTAATAATT
GCAAAGGTAACTGGGAAAAAGTCATATACTATAATCCAGCAAATTTATGAAGCAGTTAAA
TCATTGTGGACGAGAAAGCAACAAAGAAGAATCACTTCCTAAACCTAAAGGAAAATCGAA
GCTAGGAAATTCTGCTGCACTAGAAATACCTGCAAAAACAACTGACAGCCTGAAATATTC
AGTGTCCTTGCCAGCAGAACTCAGCTCTGAAACAAAGACAAAATCAGAATCCACCTCAGG
T


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LPIYTAPPLQSKYVEEQPGHLQRGFASIRSTTGHYIGWCKGVYVFMKNGIMDTVQFGKDAYIY-LKNPPQDFLPKLGVITVSALAGLVSARKXSRF-KKI
LPIYTAPPLQSKYVEE.PGHL..GFASI.STTGH.IGWCKGVYVF..NGIMDTVQFGKDAY.Y.LKNPPQDFLPKLGVITVS.LAGLVSARK.SRF....
Retrocopy
LPIYTAPPLQSKYVEE*PGHLEMGFASILSTTGH*IGWCKGVYVFVNNGIMDTVQFGKDAYVY/LKNPPQDFLPKLGVITVSGLAGLVSARKGSRF\XXX


Parental protein
AYPLGLATLGATVCYPVQSVIIAKVTGEKAYTVSQQIYGAVKSLRTK-SNKEESLPKPKEKSKLGNSATLEIPEKTTDSLKYSVSLPAELSSETKTKSES
AYPLGLAT.GATVCYPVQSVIIAKVTG.K.YT..QQIY.AVKSL.T..SNKEESLPKPK.KSKLGNSA.LEIP.KTTDSLKYSVSLPAELSSETKTKSES
Retrocopy
AYPLGLATFGATVCYPVQSVIIAKVTGKKSYTIIQQIYEAVKSLWTR\SNKEESLPKPKGKSKLGNSAALEIPAKTTDSLKYSVSLPAELSSETKTKSES


Parental protein
TSG
TSG
Retrocopy
TSG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide