RetrogeneDB ID:
retro_mputfur_736
Organism:
Location:
GL896942.1:6740441-6741110 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.31 %
Coverage:
50.79 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
EIF3E
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation initiation factor 3, subunit E [Source:HGNC Symbol;Acc:3277]

Genomic region (view in browser)





>retro_mputfur_736
AATAAATCTGTGAGTTCTCCACTTCAATCTTTTCAGCAGTAAACATGGCCAATCCACTGC
CTCTGTGTTTTTTCTTCACCCACCTCAAAGGGCATAATAACATTACTGATCTCTTCCTTT
ACCAGCCACCATATCATAATGCAATTCCGACAATGTGTCCACATATTCTGCATTGTTTTG
ATACATCCATCATTTCAAACAAAGATGTTTGAAAACGCCAGCAAGTACTAAAAGATCTGG
TTAAAGTCATTCAACAGAGTTTTACACATGTAAAGACCCAATTACAAAATGTGGTGAATA
CTTATGTGTTAACTTAGACTTCGTGTCTTGGAAAAAGCTGAAGGAGTGTGAATCAGTTCT
TGTGAATGACTTCTTGGTGGCTTGTCCTGAGAATTTCAATTAAAATGCTTATCTTTTCAT
ATATGAGACTTTTTGTGGCACCCACCTGCATATCAGCCTTAACACATGGGCAGACAGACC
GAACACGACTCTGGAAGAAGCTGAAAAGTGGATTGTCAATTTGATTAGAATGCAAGACTG
CATACAAAGACTGATTCTAAGTTAGGCCATGTGGTTATGGGTAACAATGCAGTCTCACCC
TATCAGCAAGTGATTGAAAAGACCGAAAGCCTTTCATTTAAACACCAGATGTTGGCCATG
AAAGAGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NNSVSSPLQSLQQRTWLIHW-SLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQ-ESYTYKDPITEF
N.SVSSPLQS.QQ.TW.IH...L..FF.H.KG..NI.DLFLYQP.Y.NAI.TMCPHIL....T..I.NKDV.KR.QVLKDLVKVIQQ.E.YT.KDPIT..
Retrocopy
NKSVSSPLQSFQQ*TWPIHC/PLCFFFTHLKGHNNITDLFLYQPPYHNAIPTMCPHILHCFDTSIISNKDV*KRQQVLKDLVKVIQQ/EFYTCKDPITKC


Parental protein
VECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIR-NARLDAKIDSKLGHVVMG
.E.L.VN.DF....KKL.ECESVLVND.FLVAC.E.F..NA.LFI.ETFC..H..IS.N..AD..N.T.EEAE.WIVNLIR.NARL..K.DSKLGHVVMG
Retrocopy
GEYLCVNLDF-VSWKKLKECESVLVND-FLVACPENFN*NAYLFIYETFCGTHLHISLNTWADRPNTTLEEAEKWIVNLIR/NARLHTKTDSKLGHVVMG


Parental protein
NNAVSPYQQVIEKTKSLSFRSQMLAMNIE
NNAVSPYQQVIEKT.SLSF..QMLAM..E
Retrocopy
NNAVSPYQQVIEKTESLSFKHQMLAMKEE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide