RetrogeneDB ID:
retro_mputfur_738
Organism:
Location:
GL896942.1:10201437-10201891 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.9 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
ORMDL2
Parental gene aliases:
No gene alias available
Parental gene description:
ORM1-like 2 (S. cerevisiae) [Source:HGNC Symbol;Acc:16037]

Genomic region (view in browser)





>retro_mputfur_738
ATGACTGTGGTATTGGCACACAGTGAAGTAAACCCCAACACTCAGGTGGCAAATCGCCAG
GGCATCTAGCAGGCTTACAGCCTCTCGGCGGGACTGCCACATGTGGCTCTGCTCAGCTTC
TCCTTCTTCAGCACTTCTGTTGTCTTGACTCTGACCCACATCATCGCCCTGTCTGTGCAT
GTCTTCTTACATATGGTGAAACGGACACCCTCGGAGACTCCTGATAAAGGAATGGCTCTG
CTACTGACACGTTGAGAACAGATGGACTATGGATTCCAGCTCACCTCTTCCCGCAGTTCT
CAGCATCTTTCCTATTGTACTCTGCTTCCCAGCCAGCTTCTATACTATGCAACCTGCTGC
TCCCATTCTCGTCAACACACTTCATGGATCAGCCTTCTGCTGCCTAAGTTGTCCCAACTC
TATAGGGTTTGTCCCTTTGGCATCAAACAAGTAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAMYVFLHMVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRK
M.V..AHSEVNPNT.V.N..GI..AY....GL.HV.LLS..FFS..VV.TLT..I..L...VFLHMVK.TP.ETPD.G.A.LLT..EQMDYG.Q.TSSR.
Retrocopy
MTVVLAHSEVNPNTQVANRQGI*QAYSLSAGLPHVALLSFSFFSTSVVLTLTHII-ALSVHVFLHMVKRTPSETPDKGMALLLTR*EQMDYGFQLTSSRS


Parental protein
FLSISPIILYLLASFYTKYDAAHFLINTASLLSVLLPKLPQFHGVRLFGI-NKY
....S...L......Y......H....T.S..S.LLPKL.Q...V..FGI.NKY
Retrocopy
SQHLSYCTLLPSQLLYYATCCSHSRQHT-SWISLLLPKLSQLYRVCPFGI\NKY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide