RetrogeneDB ID:
retro_mputfur_739
Organism:
Location:
GL896942.1:10668552-10669713 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.69 %
Coverage:
97.08 %
Frameshifts:
4
Stop codons:
4


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:UniProtKB/TrEMBL;Acc:G9KQ49]

Genomic region (view in browser)





>retro_mputfur_739
TCAAAAACACCATCTTATGCCCCACTTCCCATCCTAGCTCCTGCAACACAAATGTCCAGC
ACACCTGGATTTGTGGGATACAGTCCATACAGTCCTCACCCCTACAACAACTGCAGGCTG
AGAGGGATCTCAGCCACCGATAGCCAGCTCAACATCCTCTGGTATTACCATTTCAAAACA
CCCAAGTCCACCAGATACTCAGCTGATGCCTCACATGAGATACAGCAGAAAGTTCTCGGA
CCAAGTAAAAGGTTCCAACCCTGACCCAAAGGTGTGGGAGTTGGGCCAGATTATTGGTGG
CATGTAGCAAGATCTCACCAATGAAAAAAAATGAGACTATGTGAATGAATACAAAGCAGA
ACATAAATCTATGAAGGTCTATTTTAAGTTCCCTGCATACTTTCCTTACATAAATGCAAA
AAGTCATATAGAAGCTGCTCTGGAGGAAGAAAGTCGACAGAGACAGCCTCGCATGGAGAA
AGGAGAACCATATGTGAGCATTCTGCAGAAGATCCAAATGATGATGATGATGGCTTTCAG
CAAATCATACAGTCACTGTCCATTTCCGGAGACACCAACACCTCATCAGTGAAATCCCCA
GGAAGAGTGTGGTGTCAGACTTTTGGTCGGCTGCCACAACACCTAAAAGGCAAGTCCAGT
CCTTAATAGCTCAACAGCAAAAACTAGAAGCTGAACTTTTTCAAGCAGAGGAGCAATACC
AGGAAAAGAAGACGAAATTCCTGGAAAGAATAGATTCTTCTAACAATGAACATAGAAGTG
GGTGCAGTTTGAAAGTAGATGTGGGTTGGAAAAAAATTGCCCCTGAAATTGCACAGACAG
AGGAACAGGCTCGAAAAACACAGGAGGAAAGGGAAGACGAGAGAGATGGCCCAGCAAGTA
GAAGGCCGTCAGAGCAGCATGGTTCCTGAGGGAGAGCAAACTGCTAGTAAGATTGCGGAA
CAGAAAGAGCACAAGCGTATCCCAGTGGAGACAGAGGAGGTAGAAGAAGTGACAGAGAGC
CAATAGAACACTGAGGAAGGCACACCTTCTCCCGAAGACAATGAGAGTGGGCAGGAGGGG
GTGGACCAGATGGCTGAGGAGGAGCCCAGTGGTAGTAAGGCTGTCTAAGAGAGCAACAAT
GGAGGAGCCACCAATGGACCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TERPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRV-TASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKII
...PSYAP.P..APATQM.STPGFVGY.PYS...YNN.RL.G...T.S...T.S.GITI.K.P.PPD..LMP.MRYSRK..DQVK.SNPD.K.WE.G.II
Retrocopy
SKTPSYAPLPILAPATQMSSTPGFVGYSPYSPHPYNNCRLRGISATDSQL\TSS-GITISKHPSPPDTQLMPHMRYSRKFSDQVKGSNPDPKVWELGQII


Parental protein
GGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSHAEAALEEESRQRQSRMEKGEPYMSI-QPAEDPDDYDDGF-SMKHTATARFQR
GGM..DLT......Y.NEY.AE......SMK.Y...PAY..YINAKSH.EAALEEESRQRQ.RMEKGEPY.SI.......DD.DDGF.S..HT.T..F.R
Retrocopy
GGM*QDLTNXXX*DYVNEYKAE----HKSMKVYFKFPAYFPYINAKSHIEAALEEESRQRQPRMEKGEPYVSI/SAEDPNDD-DDGF/SANHTVTVHFRR


Parental protein
NHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARK
...LISEI...SVV.D..S..TT...QV.....Q..........AE....E.....K..KFLE..DS.NNE....C.LKV.V...KIA.EIAQ.EEQARK
Retrocopy
HQHLISEIPRKSVVSDFWSAATTPKRQVQSLIAQQQKLEAELFQAE----EQYQEKK-TKFLERIDSSNNEHRSGCSLKVDVGWKKIAPEIAQTEEQARK


Parental protein
RQEEREKEAAEQAERSQS-SMVAEE-ERAASKTEEKKDDESVPTETEETHLEEATESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATV
.QEERE.E....A.R..S.S....E.E..ASK..E.K.....P.ETEE...EE.TESQ.N.EEGT..PED.ESGQEGVD.MAEE..S.S....ESN....
Retrocopy
TQEEREDERDGPASRRPS\SSMVPEGEQTASKIAEQKEHKRIPVETEE--VEEVTESQ*NTEEGTPSPEDNESGQEGVDQMAEEEPSGSKAV*ESNNGGA


Parental protein
EEPP
...P
Retrocopy
TNGP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide