RetrogeneDB ID:
retro_mputfur_748
Organism:
Location:
GL896943.1:12506152-12506879 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
74.8 %
Coverage:
98.79 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
ATP6V1D
Parental gene aliases:
No gene alias available
Parental gene description:
ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D [Source:HGNC Symbol;Acc:13527]

Genomic region (view in browser)





>retro_mputfur_748
AAGACCAAATTAAAAATCTTTCCCTCATGCATGGCACAGACCATCATGAAGTCTCGATTA
AAAGGAGTACAGACAGGTTGAAACCTCCTGAAGAAAATGTCTGATGCCTTAGCTCTTTGT
TTTCAACAGATCCTAAAGAAGATAATAGGGACTAAAGTGCTGATGGGTGAAGTAATGAAG
AAGCTTCCTTTTCTTTTGCTGACACCAAGTTCATAACAGGGGATGTCAACACCACAGTTA
TCCAAAATGTAAATAAATCCTATGTGAAGATTCTAGCTAAGAAAGATAATGTATCAGGTG
TTATTTTGCCAGTATTTGAACATTACTGTGAAGGAACTGACAGTTATAAACCAGCTGGTT
TAGCGAGAGGTGGGGAACAATTGGCTAAATTAAAGAGAAATTATGTCAAAGCAGTGGAAT
TACTGATAGAAATATTTTCCCTTCAAACTTCCTTTGTTACTTTGGATGAAGCTATTAAGA
TAACCAACAAATGTGTAAATGATATTTCATATACCATTGTCCCTGGAATTGAACATACTT
GTGCTTATATCATTAGAAAACTGGATGAGAGAGAGCCAGAAGAGTTCTATTGGTTAAAGA
AAATAAAGAAGGAAAAGATTCTCCAGGAAAATTGGAAAAGGACTTGGAGCAATAGAGGGC
AGCTGGAGAGGTGATGGAGCCTGTTAATCTTTTGACTGAAGAGAAGAATGAAGATCTTCT
GCTGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMR-EAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVA
K....IFPS.MAQTIMK.RLKG.QTG.NLLKK.SDAL.L.F.QILKKII.TK.LMGEVM..EA.FS.A..KF..GD..TTVIQNVNK..VKI.AKKDNV.
Retrocopy
KTKLKIFPSCMAQTIMKSRLKGVQTG*NLLKKMSDALALCFQQILKKIIGTKVLMGEVMK/EASFSFADTKFITGDVNTTVIQNVNKSYVKILAKKDNVS


Parental protein
GVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL
GV.LPVFEHY.EGTDSY...GLARGGEQLAKLKRNY.KAVELL.E..SLQTSFVTLDEAIKITN..VN.I...I.P.IE.T.AYII..LDERE.EEFY.L
Retrocopy
GVILPVFEHYCEGTDSYKPAGLARGGEQLAKLKRNYVKAVELLIEIFSLQTSFVTLDEAIKITNKCVNDISYTIVPGIEHTCAYIIRKLDEREPEEFYWL


Parental protein
KKIQEKKKILKE-KSEKDLEQRRAAGEVMEPANLLAEEKDEDLLFE
KKI..K.KIL.E.K.EKDLEQ.RAAGEVMEP.NLL.EEK.EDLL.E
Retrocopy
KKI-KKEKILQE/KLEKDLEQ*RAAGEVMEPVNLLTEEKNEDLLLE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide