RetrogeneDB ID:
retro_mputfur_749
Organism:
Location:
GL896944.1:1936775-1937063 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.6 %
Coverage:
82.91 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL36
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L36 [Source:HGNC Symbol;Acc:13631]

Genomic region (view in browser)





>retro_mputfur_749
GCAGCAGCTGTGGCTCTGCGCTCCCCTGAAGCCGTGGGCCTCAACAAGGGCCACAAGGTG
ACCAAGGACACAAGCCAGCAGAAACACAGCCACCACAGCGGATGCCTCGCCCAACACACA
GGTATGTGCAGGACATGATCCAAGAGACATGTGGCTTCACTGCATGTGAGCGCAGCGCCG
TGACACTGCTCAAGGTCTCCAAGGACAAGCGGGCCCTCAAGGTAAACAAAAAGTATGGGG
ACACACATCTGTGCCAAGAGGACAACAGATGAGATGAGCAAGTTCCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SAAMALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHT-KFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVG-THIRAKRKREELSNVL
.AA.ALR.P.AVGLNKGHKVTK..S...HS...G.L..HT...V.DMI.E.CGF...ER.A..LLKVSKDKRALK...K..G.THI.AKR...E.S..L
Retrocopy
AAAVALRSPEAVGLNKGHKVTKDTSQQKHSHHSGCLAQHT/RYVQDMIQETCGFTACERSAVTLLKVSKDKRALK-VNKKYG\THICAKRTTDEMSKFL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide