RetrogeneDB ID:
retro_mputfur_753
Organism:
Location:
GL896945.1:239599-240058 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.27 %
Coverage:
73.3 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_753
TCCAAACTGCAAGCACAAGTGTGCATTGGTGGGAAAGAAACTGCTCGCCTGAAGAAGGTG
GTTTATAGAACAGCTACAGTGGATGATAAAAAAAAAAAAAAACTTCAGTTCTCCTTAAAG
AAGTTAGGGGTAAACAGTATGTCTGGTATTGAAGAAGTGAGTATGTTCACAGACCAAGGA
ACAGCGATCCACTCTCACAACCCCAAAGTTCAGGCATCGCCAGTGACAAACACTTTCACC
ATTTTGGGCCATGCTGAGACAAAGCAGTTGACAGAAATGCTACCCACTGTCTTAAACCAA
ATTGGTGCAGACAGTCTGACTAGCTGAAGAAGACTGGCTGAAGTTCTGCCCACACAGTCT
GTGGACGGAAAAGCCCCACTTGCTGCCGGAGAGGAGGAAGGTGATGACGTTCCAGATCTT
GTGGAGAATCGTGATGAAGCTTCCAAGAATGAAGCAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AKLQAQVRIGGKGTARRKKKVVHRTATADDKK---LQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILN
.KLQAQV.IGGK.TAR.KK.VV.RTAT.DD.....LQFSLKKLGVN..SGIEEV.MFT.QGT.IH..NPKVQAS...NTFTI.GHAETKQLTEMLP..LN
Retrocopy
SKLQAQVCIGGKETARLKK-VVYRTATVDDXXXXXLQFSLKKLGVNSMSGIEEVSMFTDQGTAIHSHNPKVQASPVTNTFTILGHAETKQLTEMLPTVLN


Parental protein
QLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
Q.GADSLTS.RRLAE.LP.QSVDGKAPLA.GE...D.VPDLVEN.DEASKNEAN
Retrocopy
QIGADSLTS*RRLAEVLPTQSVDGKAPLAAGEEEGDDVPDLVENRDEASKNEAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide