RetrogeneDB ID:
retro_mputfur_754
Organism:
Location:
GL896945.1:725892-726248 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.0 %
Coverage:
54.63 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
MOB1A
Parental gene aliases:
No gene alias available
Parental gene description:
MOB kinase activator 1A [Source:HGNC Symbol;Acc:16015]

Genomic region (view in browser)





>retro_mputfur_754
GAACTCTGCACTGAAGCAAGCTGTCTAGTCATGTCTGCAGGTCCAAGATCTGAATATCAT
TGGGAAGATGCTATTAATATTAAGGCCCAGCCAAAGGTTCTGTTCCAAAATATATTGACT
ATTTGATGGTTTGAGTTCAGGGTTAACTTGACCATGAAATCCTTTTTCCTTTTAAGATTG
GTGTTCCATTTTCTCAAAACTTTGTATCTGTGATAAAGACTATTCTAAAGCATTTGTTCA
AGGTTTATATCCATATTTCTTGCCAACACTTTGATTCTGTGATGCAGCTGCAAGGAAAGA
CCTGCCACAACACACATCCTTTAAGTATTTTTATTTGTTTCAAAGTTCAATTTCAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EFCTEASCPVMSAGPRYEYHWADGTNIKK-PIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQE
E.CTEASC.VMSAGPR.EYHW.D..NIK..P.K.S.PKYIDYLM..VQ..LD.E.LFP.KIGVPF..NF.SV.KTILK.LF.VY.HI..QHFDSVMQLQ.
Retrocopy
ELCTEASCLVMSAGPRSEYHWEDAINIKA/PAKGSVPKYIDYLMV*VQG*LDHEILFPFKIGVPFSQNFVSVIKTILKHLFKVYIHISCQHFDSVMQLQG


Parental protein
EAHLNT-SFKHFIFFVQEFN
....NT.....FI.F...F.
Retrocopy
KTCHNTHPLSIFICFKVQFH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide