RetrogeneDB ID:
retro_mputfur_755
Organism:
Location:
GL896945.1:4404280-4404701 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.27 %
Coverage:
65.89 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
RAN
Parental gene aliases:
No gene alias available
Parental gene description:
RAN, member RAS oncogene family [Source:HGNC Symbol;Acc:9846]

Genomic region (view in browser)





>retro_mputfur_755
GTTAAGTTCAATGTAGGGAATACAGGGGGTCAGGAGAAATTTGGTGGACCAAGAGATGGC
TGTTATATATGAATTCCGGGTGCCGTCGTGATGTCTGATGTAGCACTGAGCGTTACTTCC
AAGGATGTGCCTCACTGGCAGAGAGATTTGGTACAAGTGTGTGAAAATGTCCCCATCACG
TCGGGTGACATCAAAGTGGGTGTTAAGGACAGGAAAGTTAAAGCAAAATCCATCATCCTC
CATCGAAAGAAGAATCTTCAGTACTGTGACGTTTCTGCTCAAAGTAACCACAAACTTTGA
AAAGCTCTTCCTTTGGCTTGCTTGAAGACTTATTGGAAACTCTCACTTGAAGTTCATGGT
CATGGCCATTCTTGCCCCACCAGAGGTGAGGACAGATACAGTTCTGGTAGTGCGGTATGA
G


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQQYYDISAKSNY-N
.KFNV..T.GQEKFGG.RDG.YI....A..M.DV...VT.K.VP.W.RDLV.VCEN.PI.....KV..KDRKVKAKSI..HRKKNL.QY.D.SA.SN..N
Retrocopy
VKFNVGNTGGQEKFGGPRDGCYI*IPGAVVMSDVALSVTSKDVPHWQRDLVQVCENVPITSGDIKVGVKDRKVKAKSIILHRKKNL-QYCDVSAQSNH\N


Parental protein
FEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYE
FEK.FLWLA..LIG...L.F..M..LAPPEV..D..L...YE
Retrocopy
FEKLFLWLA*RLIGNSHLKFMVMAILAPPEVRTDTVLVVRYE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide