RetrogeneDB ID:
retro_mputfur_757
Organism:
Location:
GL896945.1:6959259-6961125 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.22 %
Coverage:
84.52 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Tatdn2
Parental gene aliases:
No gene alias available
Parental gene description:
TatD DNase domain containing 2 [Source:MGI Symbol;Acc:MGI:3576210]

Genomic region (view in browser)





>retro_mputfur_757
CTCAGCCCCTCCCTAGAGGAAATGGCTTCTTTCGAGGAGGCCTACCGCTTTAGGAGCAGT
TCCAGACAGAGTGCCAGTAACTCCACTAACTCTGAATTTGCAGCCCAGGCTGAGGGTCAC
AGTGATAAGTCCGAGGACCCAAACAATGTCAGGAGAAAGAGTGCTACACTGCATGACCAA
AGCGCTCCATTCATCTATGGGAAGGGTATCCAGGGCACCCAGGGAAAACTGATGCCAGAA
GCAGAGGAAGCTGTTGGTGCAAAACCCAGCAGAAGAGAGCATCTCAGCCCTGGACAAAGA
CCTGCCAGGGTCGTCACCTTCTCTGCTCCTCCGAAAAAGCAGCTGCCAGCCCCCGAGGTC
AGAGTGGAGAAGGAAATGATAGCGATAGAAGTCAACAGTTTTGGTAATAGGAGAGTGATT
ATGGATCCGCAGGAGAAACCCTGTAAGAAGTTGCCAGGTGACAGAACGGTGCTCAATTTG
GAAAAAGGCTGTCCGGTCCCCAAATTTCTAGACAGACGTGACTGTTGTTCAGAGATCCAA
AAGCATCAAGAAAGGGAGGCAATCGCTGAGCGCCCCTTTTCACTTAGTCACCCGCCTGGT
GTAGAAGAGCTAGCTGCAGCCAGATTCCCTCAGGAGAAGCCAGTCTCCTTGGGTTTCTCA
AGAGTTTCAAAGCCTCCATCCTTCACCACTGGTGGTGTCCCGGACCAACCTCATTTGCAC
AGGGGTCTGCGGCAGGCCTATACCAGCTACTGGAGCAGCAGTCCCCAGCCTTCTTACTCT
CCCTCTGTGGGCAGCAGCAGCGACAGCACACCCCAGGCCGGGAGGAACAGCCGCAGCTTT
CTCAGTGATTATCCTTCCGGCTCAGAAATGCACTTCCAAAACTGGTCCAGAGACTGGAAG
GCATTAGAGGAAGGTCCATCCCTGAACTTTCATGCCTCTCGTTTCTCCAGAAGTTTAGAA
GCCCGGGAGCAAACCGTCCAAGAGGAGACCACATCATATCCTTTTGGAGAATATGTGTCT
AATTTGGGGCCCAGATGCCACTGGAATCGAGGCCTAGGTCATGGTTTCATTGACACCCAT
TGCCACTTGGATATTCTCTACTCCAAGCTGTCTTTCAAAGGGACCTTTAGCAAGTTCACA
GAAATATACAACTATACCTTTCCTAAGGAATTTCAGGGCTGCATCTCTGATTTTTGTGAT
CCTCGCACACTAAGGGATGGCCTCTGGGAGGAGCTGCTGAAAGATGATCTGGTTTGGGGG
GCCTTCGGCTGTCACCCCCATTTTGCACGTTACTACAATGACACTCAAGAAAGAAAGCTT
CTGTACGCCTTACGGCACCCCAAGGCCATAGCGTTTGGAGAGATGGGCTTAGATTACTCT
TACAAGTGTACCACCCCAGTTCCACAGCAGCACAGGGTATTTGAGAGGCAGCTGCAGCTG
GCCGTGTCTCTGAAGAAGCCCCTGGTGATCCACTGCCGAGAAGCTGATGAAGATCTGCTG
GGCATCATGAAAAGAAGAGTGCCCCCTGACTACAAGATCCATAGGCATTGCTTCACGGGC
ACCTACCCGCTCATCGAGCCCCTCTTGAAGTATTTTCCCAACATGTCTGTGGGGTTCACA
GCGGTCCTGACCTACTCTTCTGCCTGGGAGACCCGCGAGGCTCTGAAAATGATCCCACTG
GACAGAATCGTTGTGGAAACTGATGCGCCCTACTTCCTGCCTCGTGGGGTTCCCAAAAGC
GTCTGCCAGTATGCCCACCCGGGCCTGGCCCTGCATACGGTTCGAGAGATTGCCAGAGTC
AAAGGTCAGCCTCTCTCCTACACCTTGGCCATCTTGCGCAAGAACACTAGTTACCTTTAC
AATCTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VNPSPEEMASLEEEACSLKVDSKDSSRNSTNSEFAAEAEGQNDTNEEPNKVQKRKRDRFRDQGSTVIYLKAIQGILGKSMPKRKGEATTRPVLSKGERPS
..PS.EEMAS.EE.A......S..S..NSTNSEFAA.AEG..D..E.PN.V..RK.....DQ....IY.K.IQG..GK.MP.........P..S..E..S
Retrocopy
LSPSLEEMASFEE-AYRFRSSSRQSASNSTNSEFAAQAEGHSDKSEDPNNV-RRKSATLHDQSAPFIYGKGIQGTQGKLMPEAEEAVGAKP--SRREHLS


Parental protein
RGEEPVRSVTVSPPPKGKESAPEVRAEDDEKAELERSSFCDRRVVIDPQEKPSEETAGARRTV-LDKHSPALEFLDDSDSNLESQKPKEREVVIEHTSSG
.G..P.R.VT.S.PPK....APEVR.E..E....E..SF..RRV..DPQEKP.....G.R....L.K..P...FLD..D...E.QK..ERE...E...S.
Retrocopy
PGQRPARVVTFSAPPKKQLPAPEVRVEK-EMIAIEVNSFGNRRVIMDPQEKPCKKLPGDRTVLNLEKGCPVPKFLDRRDCCSEIQKHQEREAIAERPFSL


Parental protein
SDWSDVDEVSTVRFSQEEPSSLKVSTVPEPSAFPTDYVMYPPHLYSSPWCDYASYWTSSPKPSGYPSVGSSGGDPLQVGRSIRGLLSDYSPHSTVSSQNT
S....V.E....RF.QE.P.SL..S.V..P..F.T..V...PHL.......Y.SYW.SSP.PS..PSVGSS.....Q.GR..R..LSDY...S....QN.
Retrocopy
SHPPGVEELAAARFPQEKPVSLGFSRVSKPPSFTTGGVPDQPHLHRGLRQAYTSYWSSSPQPSYSPSVGSSSDSTPQAGRNSRSFLSDYPSGSEMHFQNW


Parental protein
SRD-QELTEGRSQNSRSFRFSRSSEEEVEEKRALQEEAPPRPCGGHASSSLPRNHRESGLEGGFIDTHCHLDMLYSKLSFKGSFTKFRKIYSSSFPKEFQ
SRD...L.EG.S.N....RFSRS.E.........QEE....P.G...S...PR.H...GL..GFIDTHCHLD.LYSKLSFKG.F.KF..IY...FPKEFQ
Retrocopy
SRDWKALEEGPSLNFHASRFSRSLEAR---EQTVQEETTSYPFGEYVSNLGPRCHWNRGLGHGFIDTHCHLDILYSKLSFKGTFSKFTEIYNYTFPKEFQ


Parental protein
GCISDFCDPRTLTDCLWEELLKEDLVWGAFGCHPHFARYYSESQERNLLQALRHPKAVAFGEMGLDYSYKCTTPVPEQHKVFERQLQLAVSLKKPLVIHC
GCISDFCDPRTL.D.LWEELLK.DLVWGAFGCHPHFARYY...QER.LL.ALRHPKA.AFGEMGLDYSYKCTTPVP.QH.VFERQLQLAVSLKKPLVIHC
Retrocopy
GCISDFCDPRTLRDGLWEELLKDDLVWGAFGCHPHFARYYNDTQERKLLYALRHPKAIAFGEMGLDYSYKCTTPVPQQHRVFERQLQLAVSLKKPLVIHC


Parental protein
READEDLLNIMKKFVPSDYKIHRHCFTGSYPVIEPLLKHFPNMSVGFTAVLTYSSAWEARDALKQIPLERIIVETDAPYFLPRQVPKSLCQYAHPGLALH
READEDLL.IMK..VP.DYKIHRHCFTG.YP.IEPLLK.FPNMSVGFTAVLTYSSAWE.R.ALK.IPL.RI.VETDAPYFLPR.VPKS.CQYAHPGLALH
Retrocopy
READEDLLGIMKRRVPPDYKIHRHCFTGTYPLIEPLLKYFPNMSVGFTAVLTYSSAWETREALKMIPLDRIVVETDAPYFLPRGVPKSVCQYAHPGLALH


Parental protein
TVREIARVKDQPLSHTLATLRENTSRLYNL
TVREIARVK.QPLS.TLA.LR.NTS.LYNL
Retrocopy
TVREIARVKGQPLSYTLAILRKNTSYLYNL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide