RetrogeneDB ID:
retro_mputfur_761
Organism:
Location:
GL896945.1:11150711-11151406 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.55 %
Coverage:
55.92 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
EEF1A2
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation elongation factor 1 alpha 2 [Source:HGNC Symbol;Acc:3192]

Genomic region (view in browser)





>retro_mputfur_761
ACAGTAGCGTTTGTGCCAATTTCTGGTTGGAATTGTGACAACATGCTGAAGCCCAGTGCT
AACATGCCTTGGTTTAAGGGATTGAAAGTCACCTGTAAAGATGGGAATGCAAGTAGAACC
ACATTGCTTGAGGCTCTGGATTATATTCTACCACCAACTTGTCCAACTGACAAGCCCTTT
GTGTCTGTTTCTTGAGGATGTCTACAAAATTAGTGGTATTGGTGCTGTCCCTGTGGGTGG
AGTGGAGACTGGTGTTCTTAAACCTGGCATGATGGTCACCTTTGCTCCAGTCAATGTTAC
AACTAAATTAAAGTTTGTTGAGATGCACCACGAAGCTTTGAGTGGGACAATGTGGACATC
AATGTCATGAATGTATCTGTCAACAATGTTTATTGTGGCAATGTGGTTGGTGACAGCAAA
AATGACCCACCAATGGAAGCAGCTGGCTTTATGGCTCGGGTGATTATCCTGAATCATCCT
GGCTGAATCATTGCTGGATATGCACCTGTGCTGGACTGTCACACAACTCACATTGCTTGC
AAGTTTGCTGAGCTGAAGGAGAGGGTAGATCATCATTCTGGAAAAAAGCTGGAAGATGGT
CCCAAGTTCTTCAAATCTAGTGATCTCGTCATCATTGATATGTTCTTGGCAAGCCTATGT
GTGTTGAGAGCTTCTCTGACTATCCTCCTCTGGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKP-LRLPLQDVYKIGGIGTVPVGRVETGVLRPGMVVTFAPVNI
TV.FVPISGW..DNML.PS.NMPWFKG.KV..K.GNAS...LLEALD.ILPPT.PTDKP.L.L.L.DVYKI.GIG.VPVG.VETGVL.PGM.VTFAPVN.
Retrocopy
TVAFVPISGWNCDNMLKPSANMPWFKGLKVTCKDGNASRTTLLEALDYILPPTCPTDKP\LCLFLEDVYKISGIGAVPVGGVETGVLKPGMMVTFAPVNV


Parental protein
TTEVKSVEMHHEALSEALPG-DNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSG
TT..K.VEMHH....EAL.G.DNV..NV.NVSV.....GNV.GDSK.DPP.EAA.F...VIILNHPG.I.AGY.PV.DCHT.HIACKFAELKE..D..SG
Retrocopy
TTKLKFVEMHH----EALSG/DNVDINVMNVSVNNVYCGNVVGDSKNDPPMEAAGFMARVIILNHPG*IIAGYAPVLDCHTTHIACKFAELKERVDHHSG


Parental protein
KKLEDNPKALKSGDAAIVEM-VPGKPMCVESFSQYPPLD
KKLED.PK..KS.D..I..M.V.GKPMCVESFS.YPPLD
Retrocopy
KKLEDGPKFFKSSDLVIIDM/VLGKPMCVESFSDYPPLD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide