RetrogeneDB ID:
retro_mputfur_763
Organism:
Location:
GL896945.1:3500992-3501400 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.57 %
Coverage:
100.0 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL28
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L28 [Source:HGNC Symbol;Acc:10330]

Genomic region (view in browser)





>retro_mputfur_763
ATGTCCTCCCACCGGCAATGGATGGTGGGGCAGAAGTGCTCCAGCTTCCTGGTGGAGAGG
AACAAGCAGGTGTACAGCACTGACCCCAATAACCTGAAGGCAAACAAGTCCTTCCACTAC
ATGGGCTGATTCACCGCTAGACTCTGGGTGTGGAGCCCAGTCCCCGCAACAGAGATGTGG
TGGTGGTCATGAAGCAGAGATCCCGCCAGTGAAAACCCACTACCACCTGCTTGCGAGTCA
CCAGGAACCAGAAGGTCCAGGAACCCTGAGCAGCACCAGGCCCGTCATCCGCAAGAACGA
GTACCGCCCAGATCTGCACATGACCGCCATTCACAAAGCCAGCACCATTCTGCGCAGCCA
GAAGCTCCTTATGGTGAAGAGGAAGTGACCCGCCCCACAAAGAGCTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRY-NGLIHRKTVGVEPAADGKGVVVVMKRRSGQRKPATSYVRTTINKNAR-ATLSSVRHMIR
MS.H.QWMV...CSSFL..RNKQ.YST.PNNLKA..SF.Y..GLIHR.T.GVEP......VVVVMK.RS.Q.KP.T...R.T.N......TLSS.R..IR
Retrocopy
MSSHRQWMVGQKCSSFLVERNKQVYSTDPNNLKANKSFHY/HGLIHR*TLGVEPSPRNRDVVVVMKQRSRQ*KPTTTCLRVTRNQKVQ/GTLSSTRPVIR


Parental protein
KNKYRPDLRMAAIRRASAILRSQKPVMVKRK-RARPTKSS
KN.YRPDL.M.AI..AS.ILRSQK..MVKRK...RPTKSS
Retrocopy
KNEYRPDLHMTAIHKASTILRSQKLLMVKRK/VTRPTKSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide