RetrogeneDB ID:
retro_mputfur_766
Organism:
Location:
GL896945.1:8601460-8601783 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.21 %
Coverage:
62.16 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
DRAP1
Parental gene aliases:
No gene alias available
Parental gene description:
DR1-associated protein 1 (negative cofactor 2 alpha) [Source:HGNC Symbol;Acc:3019]

Genomic region (view in browser)





>retro_mputfur_766
CAGCAGCCTGACTTCTTGAAGGACCTGGTGGCCTCTGTGCCTGAGATGCAGGATGACAGG
GAAGATAACACCATGGAAAGGGAGAGGGGCCAGAAGCCAGGCAACAATGGCTGGAGGAAT
AGGAGGATAGGAAGCAAAGGCAAGGACAAGAAGCTGTCAGGGATGGACTTGGAGCAGGAG
GGTGGGTCTGAGGACATAGATGCGGACAGGGAAGATGAGACACCAGGGGCTCCACCTCAG
TCCAGCCACCCCCTGCCCACTTTTAGAGTCCCCTCATGCCCTTCACTTTGACTTTGCCTT
TGTTGCTAGCACCTTCTCTCCCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QQFDFLKDLVASVPDMQGDGEDNHMDGDKGTRRGRKPGSGGRKNGGMGSKSKDKKLSGTDSEQEDDSDDTDTDGEEETSQAPAQASH-PPAHFQSPPTPF
QQ.DFLKDLVASVP.MQ.D.EDN.M.......RG.KPG..G..N...GSK.KDKKLSG.D.EQE..S.D.D.D.E.ET..AP.Q.SH.PPAHF.SP....
Retrocopy
QQPDFLKDLVASVPEMQDDREDNTMERE----RGQKPGNNGWRNRRIGSKGKDKKLSGMDLEQEGGSEDIDADREDETPGAPPQSSH/PPAHF*SP---L


Parental protein
MPFTSTLPLPPAPPGP
MPFT.TLPL..AP..P
Retrocopy
MPFTLTLPLLLAPSLP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide