RetrogeneDB ID:
retro_mputfur_767
Organism:
Location:
GL896945.1:10565737-10566128 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.41 %
Coverage:
57.27 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
EPDR1
Parental gene aliases:
No gene alias available
Parental gene description:
ependymin related protein 1 (zebrafish) [Source:HGNC Symbol;Acc:17572]

Genomic region (view in browser)





>retro_mputfur_767
CCTTGCCAGGCGCCACAGGAGTGGGAAGACCCCTGGGTTCTGTACCCAGAGAACAGTAGG
AGCAACCACCAAACTCTGCTGTCCTATGACAGGCTCAGCCAGTACATACAGGTGCTTAGT
GAGCAAATGGTGCTGATCCCTGGCAAGAGGTTATTTGAATATGCTTTGTTCTATAAGGAA
AGATTGATGTTTCAGATTGAGCAAGCCACCAAGCAGTGTTCCAAGATCACCCTGACACCC
CCTGGGACCCTCTAGACATTCCTCAGCAAGCCACCACTGAGGACAAGTACTCCATAGGGG
CCCCAGGAGTGGATTGCTGTCTGGGAGTGGGGGGGCTGACAGAAAGCCAGCTAGCTCATA
TGAAACCTGGATTGGCATTTATACAGTCAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PXQAPQQWEGRQVLYRQSSGRNSRALLSYDGLNQRVRVLDERKALIPCKRLFEYILLYKDGVMFQIEQATKQCSKISLTEP-WDPLDIPQNATFEDQYSI
P.QAPQ.WE...VLY...S..N...LLSYD.L.Q...VL.E...LIP.KRLFEY.L.YK...MFQIEQATKQCSKI.LT.P.WDPLDIPQ.AT.ED.YSI
Retrocopy
PCQAPQEWEDPWVLYPENSRSNHQTLLSYDRLSQYIQVLSEQMVLIPGKRLFEYALFYKERLMFQIEQATKQCSKITLTPP/WDPLDIPQQATTEDKYSI


Parental protein
G-GPQEQI-TVQEWSDRKSARSYETWIGIYTTK
G.GP...........DRK.A.SYETWIGIYT..
Retrocopy
G/GPRSGLLSGSGGADRKPASSYETWIGIYTVR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide