RetrogeneDB ID:
retro_mputfur_773
Organism:
Location:
GL896946.1:102220-102538 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.74 %
Coverage:
92.31 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL36
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L36 [Source:HGNC Symbol;Acc:13631]

Genomic region (view in browser)





>retro_mputfur_773
ACAGCAGCCATGGCTCTGTACTACTCTACCACCATGGGCCTCAACAAGGACCACAAAGTG
ACTAAGAACATGAGCATGCACAGCTGCCGCCATGGGCACCTCACCAAGCAAACCAAGTTC
ATGCAAGATAGGATCTGAGAGTTACGCAGCTTCATCCCATACCAGCAGTATGCTATGGAG
CTGTTCAAGGTCTCCAAGGACAAGTGTGCCCTCAAGGTCATCAAGAAAAGTGTAGGGACA
CACATCCATGCCAAGAGGAAGAAAAAGGAGCTGAGCAATGATCTGGCAGCCATGAGCAAA
GAGGTTGCCAAGAAGGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SAAMALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAM
.AAMAL.Y....GLNK.HKVTKN.S...HS.R.G.LTK.TKF..D.I.E...F.PY...AMEL.KVSKDK.ALK.IKK.VGTHI.AKRK..ELSN.LAAM
Retrocopy
TAAMALYYSTTMGLNKDHKVTKNMSM--HSCRHGHLTKQTKFMQDRI*ELRSFIPYQQYAMELFKVSKDKCALKVIKKSVGTHIHAKRKKKELSNDLAAM


Parental protein
RKAAAKKD
.K..AKKD
Retrocopy
SKEVAKKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide