RetrogeneDB ID:
retro_mputfur_774
Organism:
Location:
GL896946.1:2467638-2468318 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.7 %
Coverage:
55.83 %
Frameshifts:
1
Stop codons:
5


Parental gene:
Parental gene symbol:
RPL3
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L3 [Source:HGNC Symbol;Acc:10332]

Genomic region (view in browser)





>retro_mputfur_774
AAGAAGAAGAAGGCCCACCTCATGGAGATCCAGGTGAATGGAGACATCGTGGCTGAGAAG
CTGGACTGGGCTCACAAGAGCCTGGAAAAGCACGTATGTATGAACCAAGTGTCTGGACAG
AATGAGGTGATCGTTTTCATCAGTGTCATCATTGTCATCAAGGGCAAAGGCTACAAAGGG
GTAACCAGCTCCTGGCACACCAAGAGACTACCCCACAAGATGCTCCGGGGGCTGCATAAT
ATTGCCTGTATTGGAGCATGACATTCTACCCCATGGCTTTCTCTGTGGCTTAGGCTGGAC
AGAAAGACTGCCATGGTCACACTGAGAGCAACAAGATTTACAAGATTGTCCAGGGACATC
TCATCAAGGATGGCAAAGTAAGCAAGAACAATGCTTCCATTGATTATGATCTGTCTGGTG
AGAGCATCAGCCCTCTGGGTGGCTTTGCCCACTATGGTGAAGTGAACAATGCCTTTGTCA
TGCTGAAAGGCTATATGGTGGGAACCAAGAAGCAATAGCTTACATTCTGCAAGTCCTTGC
TGCTACAGACCAAAAGGTAGGCTCTGGAGAAGGCTGAGCTCAAGTTCATCAACACCACTT
CCAAGTTTAAATATGGCTGATTCCAGACTGCAGAGAAAAAGAAAGAACTCATAGAACCAC
TTAAGAAAGACCAAATTGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLR---KVACIGAWHPA-RVAFSVARA
..KKAHLMEIQVNG..VAEKLDWA...LE..V..NQV.GQ.E.I...........KG...........R..H..LR.....ACIGA.H.....AFSVA.A
Retrocopy
KKKKAHLMEIQVNGDIVAEKLDWAHKSLEKHVCMNQVSGQNEVIVXXXXXXXXXGKGYKGVTSSWHTKRLPHKMLRGLHNIACIGA*HST/PMAFSVA*A


Parental protein
GQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFID
GQK..H..TE.N.KIYKI.QG.LIKDGK..KNNAS.DYDLS..SI.PLGGF.HYGEV.N.FVMLKG..VGTKK..LT..KSLL.QTKR.ALEK..LKFI.
Retrocopy
GQKDCHGHTESN-KIYKIVQGHLIKDGKVSKNNASIDYDLSGESISPLGGFAHYGEVNNAFVMLKGYMVGTKKQ*LTFCKSLLLQTKR*ALEKAELKFIN


Parental protein
TTSKFGHGRFQTVEEKKAFMGPLKKDRIA
TTSKF..G.FQT.E.KK....PLKKD.IA
Retrocopy
TTSKFKYG*FQTAEKKKELIEPLKKDQIA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide