RetrogeneDB ID:
retro_mputfur_776
Organism:
Location:
GL896946.1:7585917-7586286 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
57.36 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
CYB5A
Parental gene aliases:
No gene alias available
Parental gene description:
cytochrome b5 type A (microsomal) [Source:HGNC Symbol;Acc:2570]

Genomic region (view in browser)





>retro_mputfur_776
CTAAGGCTTGCCACCTTCCGAAATGGCCGAACAGTTGGACCAGACTGTCGAGTATTACAC
CCTGGAAGGGACCCAGAAGCACAACCACAGCAAGAGAATCTGGCTGATTCTAGGGAAGAA
CCGTTAAGGGAACAAGTCGAAGGGGACGCTACCGAAAGTTCTGAGGATGTGGGGTACCCT
ACAGATGCTAGGGAACGTCCAAAACGTACATCATCGGGCAACTTCACCCGGATGACAGAG
CAACCAAGCCTTTGGAAACTCTCATTACTACTGCTGATTCCAGTTCCAGCTGGTGGACCC
AGCTGCGTGATCCCAGCCGTCTCAGCACCAGTGGTGGCTCTCATGTGTCACCTCTCCACA
TCGGAAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MTLYGFTPGLGAPSETRILELGFPVEAGWRPPALRTHPGGEEVLREQAGGDATESFEDVGHSTDARE-LSQTYIIGELHPDDRAKLAKPSETLITTVDSN
..L..F..G.......R.L..G...EA...P.........EE.LREQ..GDATES.EDVG..TDARE..S.TYIIG.LHPDDRA...KP.ETLITT.DS.
Retrocopy
LRLATFRNGRTVGPDCRVLHPGRDPEA--QPQQENLADSREEPLREQVEGDATESSEDVGYPTDARE/TSKTYIIGQLHPDDRA--TKPLETLITTADSS


Parental protein
SSWWT-NWVIPAISALVVALMYHLYTAED
SSWWT...VIPA.SA.VVALM.HL.T.ED
Retrocopy
SSWWT\SCVIPAVSAPVVALMCHLSTSED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide