RetrogeneDB ID:
retro_mputfur_783
Organism:
Location:
GL896947.1:12212466-12212903 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.63 %
Coverage:
57.53 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
CMSS1
Parental gene aliases:
No gene alias available
Parental gene description:
cms1 ribosomal small subunit homolog (yeast) [Source:HGNC Symbol;Acc:28666]

Genomic region (view in browser)





>retro_mputfur_783
TCAGATAGTGGAAGAGGAGGAGGTCCAGAAATAATGCAGCAGGAGACAGCTCCAGCTCCT
GCAGTGTCAAAGAAAACTAAACAGCCTAAAAATGTTTCTTGATACAACCAAAGGAAACAA
AAGAAGATGACACCAGGACAAGGAGGAGAAGAAGAAAATTACTGATGTTCTTGCAAAATC
AGAGCCCAAACCAGGGACCCCTGAAGACCTGTAGAAACTTATGAAGGACTATTACAGCAG
CCAACTGCCCAGTGATTGAATTAGAAGACCAATCATATTCCTGTTTCCTCAAGGCCAATA
ATTTGACTCCTAGTCTTTCATCATACCTAAAAGAAACCTGCCCTAAGTGGGTAAATCTTT
AGAAAAATCATAATGAGAAGAAGTTGGTCCTGATGCTGATCATATGCCCCTCTGCTCTCT
GGGCCTTGGAGCTCATT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASGGEGGGDPEMQQETAPVPALSKKTKQPK-ECFLIQPKETKEDATKTRKRR-KKKITDVLAKSEPKPGTPEDLQKLMKDYYSS-NRSVIELEELNLPDS
...G.GGG...MQQETAP.PA.SKKTKQPK..CFLIQPKETKED.T.TR.RR.KKKITDVLAKSEPKPGTPEDL.KLMKDYYSS.N..VIELE......S
Retrocopy
SDSGRGGGPEIMQQETAPAPAVSKKTKQPK/KCFLIQPKETKEDDTRTR-RR/KKKITDVLAKSEPKPGTPEDL*KLMKDYYSS\NCPVIELEDQSY--S


Parental protein
CFLKANDLTHSLSSYLKEICPKWVKLRKNHNEKKSVLMLIICSSAVRALELI
CFLKAN.LT.SLSSYLKE.CPKWV.L.KNHNEKK.VLMLIIC.SA..ALELI
Retrocopy
CFLKANNLTPSLSSYLKETCPKWVNL*KNHNEKKLVLMLIICPSALWALELI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide