RetrogeneDB ID:
retro_mputfur_784
Organism:
Location:
GL896947.1:1016341-1016967 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.71 %
Coverage:
98.6 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
RAN
Parental gene aliases:
No gene alias available
Parental gene description:
RAN, member RAS oncogene family [Source:HGNC Symbol;Acc:9846]

Genomic region (view in browser)





>retro_mputfur_784
AAATCCCAAATCCAATTCATACTTGTATTGGTTGGTGATGGTGGTACTAGAAAAACTATA
TTTGTGAAACATCATCTGACTGATAAACTTGAGAAGTACATAGCCACCTTGGATGTTGAG
GTCTGTCCTCTTATGTTCCATACCAACAGAGGACCTATTAAGTTCAATGCAGGGGATATG
GCTGGTCAGAAGAAACTTGGTGGGCTGAGAGATGGCTATTACATCCAGGCCCAGCATGCC
ATTATAATGTTTGATGTAACATCAAGAGTTATTTATAAGAATGTACCTAACTGGCATGGA
GATCTGGTACAAGTTTGTGAGAACATCCCCATGGGGCTGTGTGACAACAAAGTAGATGTT
AACAAGAAAGTTAACTCAGAATTTATTGTCTTCCACTCAAAGAAGAACCTGTAGTACTGT
GACATTTCTGCCAAAAGAATTAACTACAACTTTGAAAAGCCTTTCTTGTGTCTGCTATAA
AACTAACTGGAGACCCTAACCTGGAGTTTGTCGCCATGCCTGCTCTTGCCCCACCAGAGG
TTGTCAGGGACCTAGCTTTGGCAACACAGTAGAAGCATGATCTAGAAGTTGCTTAGACAA
CTGTTTGCCTGAATGAGGATGATGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KTGLRFRLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWH
K....F.LVLVGDGGT.KT.FVK.HLT...EK.Y.ATL.VEV.PL.FHTNRGPIKFN..D.AGQ.K.GGLRDGYYIQAQ.AIIMFDVTSRV.YKNVPNWH
Retrocopy
KSQIQFILVLVGDGGTRKTIFVKHHLTDKLEK-YIATLDVEVCPLMFHTNRGPIKFNAGDMAGQKKLGGLRDGYYIQAQHAIIMFDVTSRVIYKNVPNWH


Parental protein
RDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQQYYDISAKS-NYNFEKPFLWL-ARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLE
.DLV.VCENIP..LC.NKVD....KV....IVFH.KKNL..Y.DISAK..NYNFEKPFL.L.A.KL.GDPNLEFVAMPALAPPEVV.D.ALA.Q..HDLE
Retrocopy
GDLVQVCENIPMGLCDNKVDV-NKKVNSEFIVFHSKKNL-*YCDISAKRINYNFEKPFLCL/AIKLTGDPNLEFVAMPALAPPEVVRDLALATQ*KHDLE


Parental protein
VAQTTALPDEDDD
VA.TT....EDDD
Retrocopy
VA*TTVCLNEDDD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide