RetrogeneDB ID:
retro_mputfur_786
Organism:
Location:
GL896947.1:2766297-2767056 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.63 %
Coverage:
55.24 %
Frameshifts:
2
Stop codons:
7


Parental gene:
Parental gene symbol:
DNM3
Parental gene aliases:
No gene alias available
Parental gene description:
dynamin 3 [Source:HGNC Symbol;Acc:29125]

Genomic region (view in browser)





>retro_mputfur_786
AAGAAGGACATTAAGGCTGCCACACTGATGGAAAAGAAATTGCTTCTCTTAAATCCAGCT
TACAAACATCTTGCTGATTGGATGGGGACCCCATTCCTGCAGAAATCGCTTAGTCAGCAA
CTTACCAGTCACATTTGAGATTCTCTGTCAAACTTCAGGAACAAGCTATAAGGACAGTTG
CTCTCCACAGAAAATGAAATAGAAGCCTACAAAAACATTAAGCCAGAAGACCCTACCAGG
AAGACCAAAGCATTGCTACATGTAGGTCAACAAGTTGCTGTGGACTTTGAGAGGAGAATC
AAAGGGTCAGGTGATCAAGTAGATACCCTGAAACTCTCAAGGGGTGTGAAAATCAATTGC
ATTTTCTATGAAGGCTTTCCTTCTGAGATAGTAAAGATGGAGCTCAGTGAGAAAGAACTA
TGAGGAGAAATAACCTACGCAATCAAAAACATGCACTGTATCAGGACAGGGTTGTTTATT
CCAGACATGGCAATCCAAGCAATAGTCAGAAAATGAATTGCAAAACTGATAAGGCCTTCC
TTGAGGAGTGTATATTGGTAAAATAAAAATTAATCAACACTATCAAGAAGTATACTCCCC
AAAATGGCAAACTTTCCCAGACCCTGCAAAGATATGGAAAGGATTGTTGCTAACCGTGTT
TGACAGCAAGAAGGCAAGACAATGCTCCAGGTACTACTATTGATTGACATTTGAGCCTCC
CACTATAACACCAAGGAGGAAGATTTTATTAACTATGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRI
KKDIKAA.L.E.K..L..PAY.H.AD.MGTP.LQK.L.QQLT.HI.D.L.NFRNKL.GQLLS.E.E.EAYKN.KPEDPTRKTKALL...QQ.AVDFE.RI
Retrocopy
KKDIKAATLMEKKLLLLNPAYKHLADWMGTPFLQKSLSQQLTSHI*DSLSNFRNKL*GQLLSTENEIEAYKNIKPEDPTRKTKALLHVGQQVAVDFERRI


Parental protein
EGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSV-DLVIQELINTVKKCT
.GSGDQVDTL.LS.G.KIN.IF.E.FP.EIVKME..EKEL..EI.YAIKN.H.IRTGLF.PDMA..AIV.K.I.KL..PSL.SV..LV...LINT.KK.T
Retrocopy
KGSGDQVDTLKLSRGVKINCIFYEGFPSEIVKMELSEKEL*GEITYAIKNMHCIRTGLFIPDMAIQAIVRK*IAKLIRPSLRSV/ILVK*KLINTIKKYT


Parental protein
-KKLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFA
..K.ANFPR.C...ERIVAN.....EGKT..QVLLLIDI..S..NT..EDFI..A
Retrocopy
\PKMANFPRPCKDMERIVANRV*QQEGKTMLQVLLLIDI*ASHYNTKEEDFINYA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide