RetrogeneDB ID:
retro_mputfur_787
Organism:
Location:
GL896947.1:9241081-9241457 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.6 %
Coverage:
91.91 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
H3F3A
Parental gene aliases:
No gene alias available
Parental gene description:
H3 histone, family 3A [Source:HGNC Symbol;Acc:4764]

Genomic region (view in browser)





>retro_mputfur_787
ACCTGTGGTAAGGCAAAAAGGAAGCAACTGGCTATGAAAGCCGCTCACAAGAGTGCGTCC
TTTGCTGGAGGGGTGAAGAAACCTCATCATTAACAGGCCTGATACTGTGGCACTCCGTGA
AATTAGATGTTATCAGAAGTCCACGGAACATCTGATCCAAAAACTTCCTTTCCGGTGTCT
GGTGTGACAAATTTCTCAGGACTTCAAAACAGATCTACACTTCCAGAGTGCAGCTACTGG
TGCTTTTCAGGAGGCAAGTGAGGCCTATCTGGTGGGCTTCTTTGAAGACACCAACCTATA
ACATATCCATGTCAAATGTGTCACAATTATGCCAAAAGACATCCAGCTAGCACACTGCAT
ATATGGAGGACATGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TGGKAPRKQLATKAARKSAPSTGGVKKPHR-YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
T.GKA.RKQLA.KAA.KSA...GGVKKPH...RP.TVALREIR.YQKSTE.LI.KLPF..LV..I.QDFKTDL.FQSAA.GA.QEASEAYLVG.FEDTNL
Retrocopy
TCGKAKRKQLAMKAAHKSASFAGGVKKPHH\NRPDTVALREIRCYQKSTEHLIQKLPFRCLV*QISQDFKTDLHFQSAATGAFQEASEAYLVGFFEDTNL


Parental protein
CAIHAKRVTIMPKDIQLARRIRGERA
..IH.K.VTIMPKDIQLA..I.G..A
Retrocopy
*HIHVKCVTIMPKDIQLAHCIYGGHA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide