RetrogeneDB ID:
retro_mputfur_790
Organism:
Location:
GL896948.1:2654819-2655030 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.67 %
Coverage:
89.02 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
NDUFA4
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687]

Genomic region (view in browser)





>retro_mputfur_790
AGAAGGCATTCAAGCTTGATTTCTCTCATCATATTTATTGGAGGTACTGGAGCAGCAGTG
TACCTCTTGTGTCTGTCATTGTTCAATCATGTATCTGTTGGAATGAAGATAGTAACCCAG
AGCCCAGAATGAAGTGTGTCCTAATGATCAATGCAAGTTCTGCTCAGTGAATGTAAATTA
CAGCAAACTGAAAAAGAAGGGTTCAGACTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KKHPSLIPLFVFIGAGGTGAALYVLRLALFN-PDVSWDRKNNPEP-WNKLGPNDQYKFYSVNVDYSKLKKEGPDF
..H.SLI.L..FIG..GTGAA.Y.L.L.LFN.....W....NPEP..N...PNDQ.KF.SVNV.YSKLKK.G.DF
Retrocopy
RRHSSLISLIIFIG--GTGAAVYLLCLSLFN/SCICWNEDSNPEP/QNEVCPNDQCKFCSVNVNYSKLKKKGSDF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide