RetrogeneDB ID:
retro_mputfur_793
Organism:
Location:
GL896948.1:5940900-5941225 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
60.0 %
Coverage:
50.45 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
TSPAN2
Parental gene aliases:
No gene alias available
Parental gene description:
tetraspanin 2 [Source:HGNC Symbol;Acc:20659]

Genomic region (view in browser)





>retro_mputfur_793
ATAGGCAAGGGTGTAGCTATATGATAGGCTCGGACCATATATAAAGAGGCTTATTATAAC
TATTACCCTACAGATAGGGAAAAGGGAAACAGGACTCTCGTACTTTCCACTCAACATTTT
AGTGTTGTGAAACAAAAGGTCTGAACAGGTCCAATCCATATGCCTAAAGAAGCTTCTCAG
ACACAGACATTGTATTAGTAAAATTGAGACCATAATCAGCGTTAAACTGGAATCTGTTGG
TATTGGAATTGGTGGTCTCATGATCTTTGGCATGATGTTCAGCATGGTCCTTGGCTGTGC
AATGTTAAACTCATGAGATGTGATA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IGKGVAIRHVQTMYKEAY-NDYLKDRERGNGTLI-TFHSTFQCCGKES-SEDVQQTKEKGIPVHRNNCIDEIEAIISVKLQLIGIVGIGIAGLTIFGMIF
IGKGVAI....T.YKEAY.N.Y..DRE.GN.TL..TFHSTF.CC.....SE.VQ....K....HR..CI..IE.IISVKL.....VGIGI.GL.IFGM.F
Retrocopy
IGKGVAI**ARTIYKEAYYNYYPTDREKGNRTLV/TFHSTF*CCETKG/SEQVQSICLKKLLRHRH-CISKIETIISVKLES---VGIGIGGLMIFGMMF


Parental protein
SMVLCCAIRTSRDVI
SMVL.CA...S.DVI
Retrocopy
SMVLGCAMLNS*DVI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide