RetrogeneDB ID:
retro_mputfur_794
Organism:
Location:
GL896948.1:10657186-10657519 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.29 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PAGE4
Parental gene aliases:
No gene alias available
Parental gene description:
P antigen family, member 4 (prostate associated) [Source:HGNC Symbol;Acc:4108]

Genomic region (view in browser)





>retro_mputfur_794
ATGAGTGCTCGAGTAAGATCAAAATCTAGAGGAAAGGGAGATGGAAAAAAATCTTCTAAG
CTGGATGAACCTGGAGTTGCTAAGCAACCAGGTAAAAAAAAAACACCTCAAAAAAAGGAA
CCACCTACTGAGGATCCAGATATTGAGCCTGGACAAGAGAGAGAAGAAGGAGCATGTGGG
GTTCACGAACCTGAATTGGAAGCTGAAAGCCAGGAAAAGGAAGAGGGTCTGGAAAAGACT
GGGGGTGAGCGTGGAGATGGCCCTGATGTGAAAGGGAAGACTACACCTGATCTAGCATTT
GCTGAAGTTCAAGAAGCAGGTGATGGACAGTCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSARVRSKSRGKGDGKKSSKLDEPGVAKQPGKKTPQKK-EPPTEDPEIEPGQEREEGACGVQEPELEAESQEKEKGLEKTGGESGDGPDVKGKTTPDLAF
MSARVRSKSRGKGDGKKSSKLDEPGVAKQPG........EPPTEDP.IEPGQEREEGACGV.EPELEAESQEKE.GLEKTGGE.GDGPDVKGKTTPDLAF
Retrocopy
MSARVRSKSRGKGDGKKSSKLDEPGVAKQPGXXXXXXXXEPPTEDPDIEPGQEREEGACGVHEPELEAESQEKEEGLEKTGGERGDGPDVKGKTTPDLAF


Parental protein
AKVQEAGDGQS
A.VQEAGDGQS
Retrocopy
AEVQEAGDGQS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide