RetrogeneDB ID:
retro_mputfur_797
Organism:
Location:
GL896949.1:909258-909744 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.27 %
Coverage:
67.21 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
C14orf166
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 14 open reading frame 166 [Source:HGNC Symbol;Acc:23169]

Genomic region (view in browser)





>retro_mputfur_797
CACTGCAAAGATGAAACAGAATATAGAAACTTTATTGTTTGGCCTGAAGACCAGAAAATC
TGACACTAAAAGATTGAAGACACAGGTAGTTTAAGAAACATCCACAGCAGGGACTGGCCC
AAATTCTTTGAAAAGTATCTCAGAGATGTGAACTGTCTTTTCAAGATTCAAGATCGACAA
GAAGCAATTGACTGGCTTCTTGGTTTAGCCATTAGGCTTGAATATGGAAATAATGAAAAA
TACAAGGACTTGGTACCTGATAATACAATAAATGCTGACAATGCAGCTAAAAATGCAGAG
CCATTGATCAATTCCAATGTAAATAATCTCTATTTTAAGGCTGTTGTAATGGCTTTGGCC
AACCTTCTTCAGATTCAGTATCACGATTATCCAATAATGCTTACGGCAACTCACATTTTA
GTACAGAAGCTCCTGACAAAGGAGGCAGTTACGAAAGCAAATCAAATAAAAGAGGGCATG
CTGGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLKDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNTKNADNAAKNA
.CKDETE.RNFIVW.EDQKI.H.KIED.G.LRNIHS.DWPKFFEKYL.DVNC.FKIQDRQEAIDWLLGLA.RLEYG.N.EKYKDLVPDNT.NADNAAKNA
Retrocopy
HCKDETEYRNFIVWPEDQKI*H*KIEDTGSLRNIHSRDWPKFFEKYLRDVNCLFKIQDRQEAIDWLLGLAIRLEYGNN-EKYKDLVPDNTINADNAAKNA


Parental protein
EPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPV
EPLIN..VNN..FKA.VMALANLLQIQ.H.DY..ML.A..ILVQ..LT..AV.KANQ.KEG..V
Retrocopy
EPLINSNVNNLYFKAVVMALANLLQIQYH-DYPIMLTATHILVQKLLTKEAVTKANQIKEGMLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide